We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PLC-gamma 1 Recombinant Protein Antigen

Images

 
There are currently no images for PLC-gamma 1 Protein (NBP2-38316PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PLC-gamma 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLCG1.

Source: E. coli

Amino Acid Sequence: SAYEEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSSSTELHSNEKWFHGKLGAG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLCG1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38316.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PLC-gamma 1 Recombinant Protein Antigen

  • EC 3.1.4.11
  • gamma 1 (formerly subtype 148)
  • monophosphatidylinositol phosphodiesterase
  • NCKAP3,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
  • phosphatidylinositol phospholipase C
  • phosphoinositidase C
  • phosphoinositide phospholipase C
  • Phosphoinositide phospholipase C-gamma-1
  • phospholipase C, gamma 1
  • phospholipase C-148
  • Phospholipase C-gamma-1
  • Phospholipase C-II
  • PLC11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1
  • PLC148
  • PLC-148
  • PLCG1
  • PLCgamma 1
  • PLC-gamma 1
  • PLC-gamma-1
  • PLC-II1-phosphatidyl-D-myo-inositol-4,5-bisphosphate
  • PPLCA
  • triphosphoinositide phosphodiesterase

Background

Enzymes of the phospholipase C family catalyze the hydrolysis of phospholipids to yield diacylglycerols and water-soluble phosphorylated derivatives of the lipid head groups (1). Phospholipase C gamma 1 (PLC-gamma 1) hydrolyses phosphatidylinositol-4,5-bisphosphate to the second messengers inositol-1,4,5-trisphosphate and diacylglycerol. PLC-gamma 1 also has mitogenic activity upon growth-factor-dependent tyrosine phosphorylation; however, this activity is not dependent on the phospholipase activity of PLC-gamma 1, but requires an SH3 domain (2). Also, results indicate a lipase-independent role of PLC-gamma in the physiological agonist-induced activation of Ca2+ entry (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38220
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-58912
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-44448
Species: Bv, Fi, Hu, Pm, Mu, Po
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP3-39370
Species: Hu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-31329
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
AF6868
Species: Hu
Applications: IHC, KO, WB

Publications for PLC-gamma 1 Protein (NBP2-38316PEP) (0)

There are no publications for PLC-gamma 1 Protein (NBP2-38316PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLC-gamma 1 Protein (NBP2-38316PEP) (0)

There are no reviews for PLC-gamma 1 Protein (NBP2-38316PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PLC-gamma 1 Protein (NBP2-38316PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLC-gamma 1 Products

Research Areas for PLC-gamma 1 Protein (NBP2-38316PEP)

Find related products by research area.

Blogs on PLC-gamma 1

There are no specific blogs for PLC-gamma 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PLC-gamma 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCG1