Recombinant Human PLC-gamma 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PLC-gamma 1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1192 - 1291 of Human PLCG1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LKNNYSEDLELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPRRTRVNGDNRL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PLCG1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLC-gamma 1 Protein

  • EC 3.1.4.11
  • gamma 1 (formerly subtype 148)
  • monophosphatidylinositol phosphodiesterase
  • NCKAP3,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1
  • phosphatidylinositol phospholipase C
  • phosphoinositidase C
  • phosphoinositide phospholipase C
  • Phosphoinositide phospholipase C-gamma-1
  • phospholipase C, gamma 1
  • phospholipase C-148
  • Phospholipase C-gamma-1
  • Phospholipase C-II
  • PLC11-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1
  • PLC148
  • PLC-148
  • PLCG1
  • PLCgamma 1
  • PLC-gamma 1
  • PLC-gamma-1
  • PLC-II1-phosphatidyl-D-myo-inositol-4,5-bisphosphate
  • PPLCA
  • triphosphoinositide phosphodiesterase

Background

PLCG1 - phospholipase C, gamma 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4466
Species: Hu, Mu
Applications: WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5128
Species: Hu, Mu, Rt
Applications: WB
AF2364
Species: Hu
Applications: WB, IHC
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
H00089869-R01
Species: Hu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
AF5866
Species: Hu
Applications: WB, IHC
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005335-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01) (0)

There are no publications for PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01) (0)

There are no reviews for PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLC-gamma 1 Products

Bioinformatics Tool for PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01)

Discover related pathways, diseases and genes to PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01)

Discover more about diseases related to PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01).
 

Pathways for PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01)

View related products by pathway.

PTMs for PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01)

Learn more about PTMs related to PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01).
 

Research Areas for PLC-gamma 1 Partial Recombinant Protein (H00005335-Q01)

Find related products by research area.

Blogs on PLC-gamma 1

There are no specific blogs for PLC-gamma 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PLC-gamma 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCG1
Entrez