PLAC8 Antibody

Images

 
Western Blot: PLAC8 Antibody [NBP1-90721] - Analysis in human spleen tissue.
Immunohistochemistry-Paraffin: PLAC8 Antibody [NBP1-90721] - Staining of human tonsil shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLAC8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLAC8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLAC8 Protein (NBP1-90721PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLAC8 Antibody

  • placenta-specific 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31752
Species: Hu
Applications: IHC, IHC-P
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF1640
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80815
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16463
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB8126
Species: Hu
Applications: WB, Simple Western
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6529
Species: Hu
Applications: WB, Simple Western
NB100-63270
Species: Hu
Applications: WB, ELISA
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-90721
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PLAC8 Antibody (NBP1-90721) (0)

There are no publications for PLAC8 Antibody (NBP1-90721).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLAC8 Antibody (NBP1-90721) (0)

There are no reviews for PLAC8 Antibody (NBP1-90721). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLAC8 Antibody (NBP1-90721) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLAC8 Products

Bioinformatics Tool for PLAC8 Antibody (NBP1-90721)

Discover related pathways, diseases and genes to PLAC8 Antibody (NBP1-90721). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLAC8 Antibody (NBP1-90721)

Discover more about diseases related to PLAC8 Antibody (NBP1-90721).
 

Pathways for PLAC8 Antibody (NBP1-90721)

View related products by pathway.

PTMs for PLAC8 Antibody (NBP1-90721)

Learn more about PTMs related to PLAC8 Antibody (NBP1-90721).

Blogs on PLAC8

There are no specific blogs for PLAC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLAC8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLAC8