PLA2G12B Antibody


Immunohistochemistry-Paraffin: PLA2G12B Antibody [NBP2-31780] - Staining of human kidney shows strong cytoplasmic positivity in distal tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

PLA2G12B Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFV
Specificity of human PLA2G12B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLA2G12B Protein (NBP2-31780PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PLA2G12B Antibody

  • group XIIB secretory phospholipase A2-like protein
  • group XIII secreted phospholipase A2
  • Group XIII secretory phospholipase A2-like protein
  • GXIIBMGC138151
  • GXIII sPLA2-like
  • phospholipase A2, group XIIB
  • phospholipase A2, group XIII
  • PLA2G13


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PLA2G12B Antibody (NBP2-31780) (0)

There are no publications for PLA2G12B Antibody (NBP2-31780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA2G12B Antibody (NBP2-31780) (0)

There are no reviews for PLA2G12B Antibody (NBP2-31780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLA2G12B Antibody (NBP2-31780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PLA2G12B Products

Bioinformatics Tool for PLA2G12B Antibody (NBP2-31780)

Discover related pathways, diseases and genes to PLA2G12B Antibody (NBP2-31780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA2G12B Antibody (NBP2-31780)

Discover more about diseases related to PLA2G12B Antibody (NBP2-31780).

Research Areas for PLA2G12B Antibody (NBP2-31780)

Find related products by research area.

Blogs on PLA2G12B

There are no specific blogs for PLA2G12B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLA2G12B Antibody and receive a gift card or discount.


Gene Symbol PLA2G12B