PLA2G12B Antibody

Images

 
Immunohistochemistry-Paraffin: PLA2G12B Antibody [NBP2-31780] - Staining of human kidney shows strong cytoplasmic positivity in distal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLA2G12B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLA2G12B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLA2G12B Protein (NBP2-31780PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLA2G12B Antibody

  • group XIIB secretory phospholipase A2-like protein
  • group XIII secreted phospholipase A2
  • Group XIII secretory phospholipase A2-like protein
  • GXIIBMGC138151
  • GXIII sPLA2-like
  • GXIIIsPLA2
  • phospholipase A2, group XIIB
  • phospholipase A2, group XIII
  • PLA2G13
  • sPLA2-GXIIB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37255
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008399-D01P
Species: Hu, Rt
Applications: WB
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83367
Species: Hu
Applications: WB, IHC, IHC-P
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
AF4258
Species: Mu
Applications: WB, IP
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-84449
Species: Hu
Applications: WB, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
H00003249-P01
Species: Hu
Applications: WB
NBP2-31780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PLA2G12B Antibody (NBP2-31780) (0)

There are no publications for PLA2G12B Antibody (NBP2-31780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA2G12B Antibody (NBP2-31780) (0)

There are no reviews for PLA2G12B Antibody (NBP2-31780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLA2G12B Antibody (NBP2-31780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLA2G12B Products

Bioinformatics Tool for PLA2G12B Antibody (NBP2-31780)

Discover related pathways, diseases and genes to PLA2G12B Antibody (NBP2-31780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA2G12B Antibody (NBP2-31780)

Discover more about diseases related to PLA2G12B Antibody (NBP2-31780).

Research Areas for PLA2G12B Antibody (NBP2-31780)

Find related products by research area.

Blogs on PLA2G12B

There are no specific blogs for PLA2G12B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLA2G12B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G12B
Uniprot