PKD2L1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PKD2L1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PKD2L1
  
  

  Source: E.coli

  Amino Acid Sequence: YNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PKD2L1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25054It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PKD2L1 Recombinant Protein Antigen

• PCL
• PKD2L
• PKD2L1
• PKD2Lpolycystin-L
• PKDL
• PKDLpolycystin-L1
• polycystic kidney disease 2-like 1 protein
• polycystic kidney disease 2-like 1
• Polycystin-2 homolog
• Polycystin-2L1
• Polycystin-L
• Polycystin-L1
• transient receptor potential cation channel, subfamily P, member 3
• TRPP3

Background

PKD2L1 encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation channel. Alternative splice variants have been described but their full length sequences have not been determined; FUNCTION: May function as a subunit of an ion channel and act as a transducer of calcium-mediated signaling. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed in adult heart, skeletal muscle, brain, spleen, testis, retina and liver. According to Ref.1 expressed at high levels in fetal tissues, including kidney and liver, and down-regulated in adult tissues. It has been found to be expressed in fetal brain, but not expressed in fetal lung, liver or kidney. Isoform 4 appears to be expressed only in transformed lymphoblasts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PKD2L1