We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PKD2L1 Recombinant Protein Antigen

Images

 
There are currently no images for PKD2L1 Recombinant Protein Antigen (NBP3-25054PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PKD2L1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PKD2L1

Source: E.coli

Amino Acid Sequence: YNKTLLRLRLRKERVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTATFTKFDRDGNRILDEKEQE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
PKD2L1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25054It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PKD2L1 Recombinant Protein Antigen

  • PCL
  • PKD2L
  • PKD2L1
  • PKD2Lpolycystin-L
  • PKDL
  • PKDLpolycystin-L1
  • polycystic kidney disease 2-like 1 protein
  • polycystic kidney disease 2-like 1
  • Polycystin-2 homolog
  • Polycystin-2L1
  • Polycystin-L
  • Polycystin-L1
  • transient receptor potential cation channel, subfamily P, member 3
  • TRPP3

Background

PKD2L1 encodes a member of the polycystin protein family. The encoded protein contains multiple transmembrane domains, and cytoplasmic N- and C-termini. The protein may be an integral membrane protein involved in cell-cell/matrix interactions. This protein functions as a calcium-regulated nonselective cation channel. Alternative splice variants have been described but their full length sequences have not been determined; FUNCTION: May function as a subunit of an ion channel and act as a transducer of calcium-mediated signaling. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Expressed in adult heart, skeletal muscle, brain, spleen, testis, retina and liver. According to Ref.1 expressed at high levels in fetal tissues, including kidney and liver, and down-regulated in adult tissues. It has been found to be expressed in fetal brain, but not expressed in fetal lung, liver or kidney. Isoform 4 appears to be expressed only in transformed lymphoblasts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90268
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB7265
Species: Mu
Applications: IHC, WB
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC,  IHC-P, WB
MAB2806
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF6270
Species: Hu
Applications: ICC
AF8065
Species: Hu
Applications: WB
AF2364
Species: Hu
Applications: IHC, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-15385
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-84197
Species: Hu
Applications: ICC/IF,  IHC-P
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00009242-M01
Species: Hu
Applications: ELISA, WB

Publications for PKD2L1 Recombinant Protein Antigen (NBP3-25054PEP) (0)

There are no publications for PKD2L1 Recombinant Protein Antigen (NBP3-25054PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKD2L1 Recombinant Protein Antigen (NBP3-25054PEP) (0)

There are no reviews for PKD2L1 Recombinant Protein Antigen (NBP3-25054PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PKD2L1 Recombinant Protein Antigen (NBP3-25054PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKD2L1 Products

Blogs on PKD2L1

There are no specific blogs for PKD2L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PKD2L1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PKD2L1