PKC mu Antibody

Product Discontinued

PKC mu Antibody Summary

• Immunogen: The immunogen for this antibody is PKC mu - N-terminal region. Peptide sequence SPGFEQKSPSESFIGREKRSNSQSYIGRPIQLDKLLMSKVKVPHTFVIHS.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:1000
• Theoretical MW: 102 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PKC mu Antibody

• EC 2.7.11
• nPKC-D1
• nPKC-mu
• PKCM
• PKC-MU
• PKD1
• PKDEC 2.7.11.13
• PRKCMPKC-mu
• PRKD1
• Protein kinase C mu type
• protein kinase C, mu
• Protein kinase D
• protein kinase D1
• serine/threonine-protein kinase D1

Background

Prkd1 converts transient diacylglycerol (DAG) signals into prolonged physiological effects, downstream of PKC. It is involved in resistance to oxidative stress through activation of NF-kappa-B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKD1
• Uniprot:
  • NP_032884(Mouse)