PKC alpha Antibody - BSA Free

Images

 
Independent Antibodies: Western Blot: PKC alpha Antibody [NBP1-87269] - Analysis using Anti-PRKCA antibody NBP1-87269 (A) shows similar pattern to independent antibody NBP1-87268 (B).
Immunocytochemistry/ Immunofluorescence: PKC alpha Antibody [NBP1-87269] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Immunohistochemistry-Paraffin: PKC alpha Antibody [NBP1-87269] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Western Blot: PKC alpha Antibody [NBP1-87269] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: PKC alpha Antibody [NBP1-87269] - Lane 1: Marker {kDA] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Huan Cerebral Cortex tissue.
Orthogonal Strategies: Western Blot: PKC alpha Antibody [NBP1-87269] - Analysis in human cell lines A-549 and Caco-2 using anti-PRKCA antibody. Corresponding PRKCA RNA-seq data are presented for the same cell ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

PKC alpha Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit PKC alpha Antibody - BSA Free (NBP1-87269) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRST
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKCA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PKC alpha Protein (NBP1-87269PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PKC alpha Antibody - BSA Free

  • AAG6
  • aging-associated gene 6
  • EC 2.7.11
  • EC 2.7.11.13
  • MGC129901
  • PKC alpha
  • PKCA
  • PKC-A
  • PKC-alpha
  • PKCAMGC129900
  • PRKACA
  • PRKCA
  • protein kinase C alpha type
  • protein kinase C, alpha

Background

Protein Kinase C (PKC) is a large superfamily of serine/threonine kinases that mediate essential cellular signals required for activation, proliferation, differentiation and survival. There are at least ten PKC isotypes that are closely related in structure but that have distinct patterns of tissue distribution and function. The PKC isotypes can be subdivided into three classes based on primary structure and biochemical properties. These are: classical or conventional PKC isotypes (cPKC), novel PKC isotypes (nPKC) and atypical PKC isotypes (aPKC). All PKC isotypes share a characteristic equence motif C1 in addition to a serine/threonine-protein kinase domain. The cPKC isotypes include PKC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP2-19846
Species: Hu, Rt, Xp
Applications: Func, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-87270
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF5134
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-90351
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-32535
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
236-EG
Species: Hu
Applications: BA
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB

Publications for PKC alpha Antibody (NBP1-87269) (0)

There are no publications for PKC alpha Antibody (NBP1-87269).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC alpha Antibody (NBP1-87269) (0)

There are no reviews for PKC alpha Antibody (NBP1-87269). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PKC alpha Antibody (NBP1-87269). (Showing 1 - 1 of 1 FAQ).

  1. We are looking into protein kinase C-alpha antibodies for immunohistochemistry on formalin fixed, paraffin embedded tissue. I see that you have many antibodies, including several monoclonals. I wanted to confirm with you that the following antibodies are specific for C-alpha. NB600-201=MC5 (an older paper suggested that this might react with alpha, beta, gamm), NB110-57356=Y124, NB110-57353=Y143. Also, if you have an comparator data or feedback regarding PKC-alpha antibodies for IHC on FFPE, that would be very helpful. We would like to pick 1 antibody that is easy to titer and robust, so that we can move forward with our studies.
    • We have never heard any feedback that these cross-react with other PKC proteins. If you have seen data that MC5 may cross-react, then I would consider avoiding this antibody if you are concerned. The immunogens for NB110-57356 and NB110-57353 come from the N- and C-terminals, which is where the PKC proteins vary the most, so these are not expected to cross-react and we have had no feedback or testing data that suggests that they do. I would recommend NB110-57356, since it has been published with. You may want to review the published data to determine if it seems this antibody will suit your needs.

Secondary Antibodies

 

Isotype Controls

Additional PKC alpha Products

Research Areas for PKC alpha Antibody (NBP1-87269)

Find related products by research area.

Blogs on PKC alpha.

There is nothing beta than PKC Alpha
cAMP-dependent protein kinase (PKA) is a Ser/Thr protein kinase that is highly conserved between species. Three distinct catalytic (C) subunits have been identified, designated C-alpha, C-beta and C-gamma, where C-alpha and C-beta are most closely rel...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKC alpha Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKCA
Entrez
Uniprot