PKC alpha Antibody


Western Blot: PKC alpha Antibody [NBP1-87269] - Analysis in human cell lines A-549 and Caco-2 using anti-PRKCA antibody. Corresponding PRKCA RNA-seq data are presented for the same cell lines. Loading control: more
Immunocytochemistry/ Immunofluorescence: PKC alpha Antibody [NBP1-87269] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Immunohistochemistry-Paraffin: PKC alpha Antibody [NBP1-87269] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Western Blot: PKC alpha Antibody [NBP1-87269] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Western Blot: PKC alpha Antibody [NBP1-87269] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). more
Western Blot: PKC alpha Antibody [NBP1-87269] - Lane 1: Marker {kDA] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Huan Cerebral Cortex tissue.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PKC alpha Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRST
Specificity of human, mouse, rat PKC alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PKC alpha Protein (NBP1-87269PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PKC alpha Antibody

  • AAG6
  • aging-associated gene 6
  • EC 2.7.11
  • EC
  • MGC129901
  • PKC alpha
  • PKCA
  • PKC-A
  • PKC-alpha
  • PKCAMGC129900
  • protein kinase C alpha type
  • protein kinase C, alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PKC alpha Antibody (NBP1-87269) (0)

There are no publications for PKC alpha Antibody (NBP1-87269).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC alpha Antibody (NBP1-87269) (0)

There are no reviews for PKC alpha Antibody (NBP1-87269). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PKC alpha Antibody (NBP1-87269). (Showing 1 - 1 of 1 FAQ).

  1. We are looking into protein kinase C-alpha antibodies for immunohistochemistry on formalin fixed, paraffin embedded tissue. I see that you have many antibodies, including several monoclonals. I wanted to confirm with you that the following antibodies are specific for C-alpha. NB600-201=MC5 (an older paper suggested that this might react with alpha, beta, gamm), NB110-57356=Y124, NB110-57353=Y143. Also, if you have an comparator data or feedback regarding PKC-alpha antibodies for IHC on FFPE, that would be very helpful. We would like to pick 1 antibody that is easy to titer and robust, so that we can move forward with our studies.
    • We have never heard any feedback that these cross-react with other PKC proteins. If you have seen data that MC5 may cross-react, then I would consider avoiding this antibody if you are concerned. The immunogens for NB110-57356 and NB110-57353 come from the N- and C-terminals, which is where the PKC proteins vary the most, so these are not expected to cross-react and we have had no feedback or testing data that suggests that they do. I would recommend NB110-57356, since it has been published with. You may want to review the published data to determine if it seems this antibody will suit your needs.

Secondary Antibodies


Isotype Controls

Additional PKC alpha Products

Bioinformatics Tool for PKC alpha Antibody (NBP1-87269)

Discover related pathways, diseases and genes to PKC alpha Antibody (NBP1-87269). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKC alpha Antibody (NBP1-87269)

Discover more about diseases related to PKC alpha Antibody (NBP1-87269).

Pathways for PKC alpha Antibody (NBP1-87269)

View related products by pathway.

PTMs for PKC alpha Antibody (NBP1-87269)

Learn more about PTMs related to PKC alpha Antibody (NBP1-87269).

Blogs on PKC alpha.

There is nothing beta than PKC Alpha
cAMP-dependent protein kinase (PKA) is a Ser/Thr protein kinase that is highly conserved between species. Three distinct catalytic (C) subunits have been identified, designated C-alpha, C-beta and C-gamma, where C-alpha and C-beta are most closely rel...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PKC alpha Antibody and receive a gift card or discount.


Gene Symbol PRKCA