PKA C alpha Antibody

Images

 
Western Blot: PKA C alpha Antibody [H00005566-D01P] - Analysis of PRKACA expression in transfected 293T cell line by PRKACA polyclonal antibody.Lane 1: PRKACA transfected lysate(40.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PKA C alpha Antibody Summary

Immunogen
PRKACA (NP_002721.1, 1 a.a. - 351 a.a.) full-length human protein. MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Specificity
Reacts with protein kinase, cAMP-dependent, catalytic, alpha.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKACA
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PKA C alpha Antibody

  • cAMP-dependent protein kinase catalytic subunit alpha
  • Cs
  • EC 2.7.11
  • EC 2.7.11.11
  • MGC102831
  • MGC48865
  • PKA C alpha
  • PKA C-alpha
  • Pkaca
  • PKCA1
  • PKCD
  • PRKACA
  • protein kinase A catalytic subunit
  • protein kinase, cAMP-dependent, catalytic, alpha

Background

cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80901
Species: Hu
Applications: IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
PP-H6812-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85409
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-79139
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for PKA C alpha Antibody (H00005566-D01P) (0)

There are no publications for PKA C alpha Antibody (H00005566-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKA C alpha Antibody (H00005566-D01P) (0)

There are no reviews for PKA C alpha Antibody (H00005566-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PKA C alpha Antibody (H00005566-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PKA C alpha Products

Bioinformatics Tool for PKA C alpha Antibody (H00005566-D01P)

Discover related pathways, diseases and genes to PKA C alpha Antibody (H00005566-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKA C alpha Antibody (H00005566-D01P)

Discover more about diseases related to PKA C alpha Antibody (H00005566-D01P).
 

Pathways for PKA C alpha Antibody (H00005566-D01P)

View related products by pathway.

PTMs for PKA C alpha Antibody (H00005566-D01P)

Learn more about PTMs related to PKA C alpha Antibody (H00005566-D01P).

Blogs on PKA C alpha

There are no specific blogs for PKA C alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKA C alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKACA
Entrez
Uniprot