PITX1 Antibody (6D4)

Images

 
Western Blot: PITX1 Antibody (6D4) [H00005307-M02] - PITX1 monoclonal antibody (M02), clone 6D4 Analysis of PITX1 expression in A-431.
Sandwich ELISA: PITX1 Antibody (6D4) [H00005307-M02] - Detection limit for recombinant GST tagged PITX1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6D4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PITX1 Antibody (6D4) Summary

Immunogen
PITX1 (NP_002644 225 a.a. - 313 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN
Specificity
PITX1 (6D4)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PITX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00005307-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PITX1 Antibody (6D4)

  • BFTpituitary homeobox 1
  • CCF
  • Hindlimb-expressed homeobox protein backfoot
  • Homeobox protein PITX1
  • paired-like homeodomain 1
  • pituitary otx-related factor
  • POTXpituitary homeo box 1
  • PTX1Paired-like homeodomain transcription factor 1hindlimb expressed homeobox protein backfoot

Background

This gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family are involved in organ development and left-right asymmetry. This protein acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-61438
Species: Hu
Applications: IHC-P
NBP2-58195
Species: Hu
Applications: ICC/IF
423-F8/CF
Species: Hu, Mu
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-83237
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008022-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
AF8016
Species: Hu
Applications: WB, IHC
H00005307-M02
Species: Hu
Applications: WB, ELISA

Publications for PITX1 Antibody (H00005307-M02)(1)


Reviews for PITX1 Antibody (H00005307-M02) (0)

There are no reviews for PITX1 Antibody (H00005307-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PITX1 Antibody (H00005307-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PITX1 Products

Bioinformatics Tool for PITX1 Antibody (H00005307-M02)

Discover related pathways, diseases and genes to PITX1 Antibody (H00005307-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PITX1 Antibody (H00005307-M02)

Discover more about diseases related to PITX1 Antibody (H00005307-M02).
 

Pathways for PITX1 Antibody (H00005307-M02)

View related products by pathway.

PTMs for PITX1 Antibody (H00005307-M02)

Learn more about PTMs related to PITX1 Antibody (H00005307-M02).

Blogs on PITX1

There are no specific blogs for PITX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PITX1 Antibody (6D4) and receive a gift card or discount.

Bioinformatics

Gene Symbol PITX1
Entrez
OMIM
Uniprot