PITPNC1 Antibody - BSA Free

Western Blot: PITPNC1 Antibody [NBP1-98515] - Titration: 1.0 ug/ml Positive Control: Mouse Small Intestine.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PITPNC1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is Pitpnc1 - middle region. Peptide sequence FLPKFSIHIETKYEDNKGSNDSIFDSEAKDLEREVCFIDIACDEIPERYY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PITPNC1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PITPNC1 Antibody - BSA Free

• cytoplasmic phosphatidylinositol transfer protein 1
• Mammalian rdgB homolog beta
• M-rdgB beta
• mrdgBbeta
• phosphatidylinositol transfer protein, cytoplasmic 1
• RDGBB
• RDGBB1
• rdgBbeta
• RDGB-BETA
• retinal degeneration B beta 1
• Retinal degeneration B homolog beta

Background

Phosphatidylinositol transfer proteins mediate the monomeric transport of lipids by shielding a lipid from the aqueous environment and binding the lipid in a hydrophobic cavity. Able to transfer phosphatidylinositol in vitro. Isoform 2 specifically binds to phosphatidylinositol but not to other phospholipids and may play a role in the phosphoinositide-mediated signaling in the neural development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PITPNC1
• Uniprot:
  • NP_665822(Mouse)