PITPN Antibody - Azide and BSA Free

Western Blot: PITPN Antibody [NBP2-94205] - Analysis of extracts of various cell lines, using PITPN at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.

Immunocytochemistry/ Immunofluorescence: PITPN Antibody - Azide and BSA Free [NBP2-94205] - Immunofluorescence analysis of L929 cells using PITPN Rabbit pAb (A12966) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PITPN Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 211-270 of human PITPNA (NP_006215.1). NFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PITPNA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL.
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PITPN Antibody - Azide and BSA Free

• MGC99649
• phosphatidylinositol transfer protein alpha isoform
• phosphatidylinositol transfer protein, alpha
• PI-TPalpha
• PI-TP-alpha
• PITPNphosphotidylinositol transfer protein
• PtdIns transfer protein alpha
• PtdInsTP alpha
• VIB1A

Background

Phosphatidylinositol transfer protein (PITPN) is a member of a diverse set of cytosolic phospholipid transfer proteins that are distinguished by their ability to transfer phospholipids between membranes in vitro. PITPN has a role with glucose homeostasis and in mammalian endoplasmic reticulum functions that interface with transport of specific luminal lipid cargoes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for PITPN Antibody (NBP2-94205)(1)

Publication using NBP2-94205

• Li FL, Fu V, Liu G et al. Hippo pathway regulation by phosphatidylinositol transfer protein and phosphoinositides Nature chemical biology Jul 4 2022 [PMID: 35788180] (WB, Human)

Bioinformatics

• Gene Symbol: PITPNA