PITPNB Antibody - BSA Free

Western Blot: PITPNB Antibody [NBP1-55310] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 12500 Positive control: 721_B cell lysate PITPNB is supported by BioGPS gene expression data to be expressed in 721_B.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PITPNB Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PITPNB(phosphatidylinositol transfer protein, beta) The peptide sequence was selected from the middle region of PITPNB. Peptide sequence ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PITPNB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PITPNB Antibody - BSA Free

• phosphatidylinositol transfer protein beta isoform
• phosphatidylinositol transfer protein, beta
• phosphotidylinositol transfer protein, beta
• PI-TP-beta
• PtdIns transfer protein beta
• PtdInsTP beta
• PtdInsTP
• VIB1B

Background

PITPNB is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.The protein encoded by this gene is found in the cytoplasm, where it catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PITPNB
• Uniprot:
  • P48739(Human)