Pit1 Antibody

Images

 
Western Blot: Pit1 Antibody [NBP2-85478] - WB Suggested Anti-POU1F1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human Liver

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Pit1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Pit1. Peptide sequence: KRRTTISIAAKDALERHFGEQNKPSSQEIMRMAEELNLEKEVVRVWFCNR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
POU1F1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Pit1 Antibody

  • CPHD1
  • GHF1
  • GHF-1pituitary-specific positive transcription factor 1
  • Growth hormone factor 1
  • Pit-1
  • PIT1pituitary-specific transcription factor 1
  • POU class 1 homeobox 1
  • POU domain class 1, transcription factor 1
  • POU domain, class 1, transcription factor 1
  • POU1F1a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-68688
Species: Hu
Applications: IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-94348
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-24677
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04850
Species: Hu, Mu, Rt
Applications: WB
H00006575-M04
Species: Hu, Mu
Applications: ELISA, WB
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
AF7388
Species: Hu
Applications: IHC
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP3-13352
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NLS836
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Pit1 Antibody (NBP2-85478) (0)

There are no publications for Pit1 Antibody (NBP2-85478).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pit1 Antibody (NBP2-85478) (0)

There are no reviews for Pit1 Antibody (NBP2-85478). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pit1 Antibody (NBP2-85478) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Pit1 Products

Bioinformatics Tool for Pit1 Antibody (NBP2-85478)

Discover related pathways, diseases and genes to Pit1 Antibody (NBP2-85478). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pit1 Antibody (NBP2-85478)

Discover more about diseases related to Pit1 Antibody (NBP2-85478).
 

Pathways for Pit1 Antibody (NBP2-85478)

View related products by pathway.

PTMs for Pit1 Antibody (NBP2-85478)

Learn more about PTMs related to Pit1 Antibody (NBP2-85478).
 

Research Areas for Pit1 Antibody (NBP2-85478)

Find related products by research area.

Blogs on Pit1

There are no specific blogs for Pit1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pit1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POU1F1