PIN/DLC8 Antibody (1H7) - Azide and BSA Free

Western Blot: PIN/DLC8 Antibody (1H7) [H00008655-M02] - Analysis of DYNLL1 expression in transfected 293T cell line by DYNLL1 monoclonal antibody (M02), clone 1H7.Lane 1: DYNLL1 transfected lysate(10.4 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: PIN/DLC8 Antibody (1H7) [H00008655-M02] - Analysis of monoclonal antibody to DYNLL1 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: PIN/DLC8 Antibody (1H7) [H00008655-M02] - Detection limit for recombinant GST tagged DYNLL1 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1H7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PIN/DLC8 Antibody (1H7) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: DYNLL1 (NP_003737.1, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH
• Specificity: DYNLL1 - dynein, light chain, LC8-type 1 (1H7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DYNLL1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIN/DLC8 Antibody (1H7) - Azide and BSA Free

• cytoplasmic dynein light polypeptide
• DLC1
• DLC1DNCLC1
• DLC8
• DLC8MGC126137
• DNCL1
• DNCL1MGC126138
• DNCLC1
• dynein light chain 1, cytoplasmic
• Dynein light chain LC8-type 1
• dynein, cytoplasmic, light polypeptide 1
• dynein, light chain, LC8-type 1,8 kDa dynein light chain
• DYNLL1
• hdlc1
• LC8
• LC8a
• PIN
• PINLC8a
• Protein inhibitor of neuronal nitric oxide synthase

Background

Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DYNLL1
• Entrez:
  • 8655(Human)
• Uniprot:
  • NP_003737(Human)