PIN/DLC8 Antibody (1H7)

Images

 
Western Blot: PIN/DLC8 Antibody (1H7) [H00008655-M02] - Analysis of DYNLL1 expression in transfected 293T cell line by DYNLL1 monoclonal antibody (M02), clone 1H7.Lane 1: DYNLL1 transfected lysate(10.4 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: PIN/DLC8 Antibody (1H7) [H00008655-M02] - Analysis of monoclonal antibody to DYNLL1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: PIN/DLC8 Antibody (1H7) [H00008655-M02] - Detection limit for recombinant GST tagged DYNLL1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1H7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PIN/DLC8 Antibody (1H7) Summary

Immunogen
DYNLL1 (NP_003737.1, 1 a.a. - 72 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH
Specificity
DYNLL1 - dynein, light chain, LC8-type 1 (1H7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DYNLL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIN/DLC8 Antibody (1H7)

  • cytoplasmic dynein light polypeptide
  • DLC1
  • DLC1DNCLC1
  • DLC8
  • DLC8MGC126137
  • DNCL1
  • DNCL1MGC126138
  • DNCLC1
  • dynein light chain 1, cytoplasmic
  • Dynein light chain LC8-type 1
  • dynein, cytoplasmic, light polypeptide 1
  • dynein, light chain, LC8-type 1,8 kDa dynein light chain
  • DYNLL1
  • hdlc1
  • LC8
  • LC8a
  • PIN
  • PINLC8a
  • Protein inhibitor of neuronal nitric oxide synthase

Background

Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58497
Species: Hu
Applications: WB, ICC/IF
H00140735-M04
Species: Hu
Applications: WB, ELISA
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27084
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00023300-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PIN/DLC8 Antibody (H00008655-M02) (0)

There are no publications for PIN/DLC8 Antibody (H00008655-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIN/DLC8 Antibody (H00008655-M02) (0)

There are no reviews for PIN/DLC8 Antibody (H00008655-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PIN/DLC8 Antibody (H00008655-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIN/DLC8 Products

Bioinformatics Tool for PIN/DLC8 Antibody (H00008655-M02)

Discover related pathways, diseases and genes to PIN/DLC8 Antibody (H00008655-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIN/DLC8 Antibody (H00008655-M02)

Discover more about diseases related to PIN/DLC8 Antibody (H00008655-M02).
 

Pathways for PIN/DLC8 Antibody (H00008655-M02)

View related products by pathway.

PTMs for PIN/DLC8 Antibody (H00008655-M02)

Learn more about PTMs related to PIN/DLC8 Antibody (H00008655-M02).
 

Research Areas for PIN/DLC8 Antibody (H00008655-M02)

Find related products by research area.

Blogs on PIN/DLC8

There are no specific blogs for PIN/DLC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIN/DLC8 Antibody (1H7) and receive a gift card or discount.

Bioinformatics

Gene Symbol DYNLL1
Entrez
Uniprot