PIM2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PIM2 Antibody [NBP1-86193] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKGGPAPLAWSL
Specificity
Specificity of human PIM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID: 22722314).
Control
PIM2 Knockout HeLa Cell Lysate
Control Peptide
Publications
Read Publications using NBP1-86193.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 20958956)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIM2 Antibody

  • EC 2.7.11.1
  • pim-2 oncogene
  • PIM2
  • pim-2h
  • proto-oncogene Pim-2 (serine threonine kinase)
  • serine/threonine protein kinase pim-2
  • serine/threonine-protein kinase pim-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81734
Species: Hu, Mu, Rt, Dr
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP1-50553
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NB100-56080
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P, KO
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-56722
Species: Hu, Mu, Rt, Ca
Applications: WB, DB, ELISA, Flow, Func, ICC/IF, IP, In vitro, B/N, Flow-CS
NB100-56104
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
7270-IL/CF
Species: Hu
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PIM2 Antibody (NBP1-86193)(2)

Reviews for PIM2 Antibody (NBP1-86193) (0)

There are no reviews for PIM2 Antibody (NBP1-86193). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PIM2 Antibody (NBP1-86193) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PIM2 Products

Bioinformatics Tool for PIM2 Antibody (NBP1-86193)

Discover related pathways, diseases and genes to PIM2 Antibody (NBP1-86193). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIM2 Antibody (NBP1-86193)

Discover more about diseases related to PIM2 Antibody (NBP1-86193).
 

Pathways for PIM2 Antibody (NBP1-86193)

View related products by pathway.

PTMs for PIM2 Antibody (NBP1-86193)

Learn more about PTMs related to PIM2 Antibody (NBP1-86193).
 

Research Areas for PIM2 Antibody (NBP1-86193)

Find related products by research area.

Blogs on PIM2

There are no specific blogs for PIM2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIM2