PIM2 Antibody

Immunocytochemistry/Immunofluorescence: PIM2 Antibody [NBP1-86193] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Product Discontinued

PIM2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKGGPAPLAWSL
• Predicted Species: Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIM2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID: 22722314).

Reactivity Notes

Reactivity reported in scientific literature (PMID: 20958956)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PIM2 Antibody

• EC 2.7.11.1
• pim-2 oncogene
• PIM2
• pim-2h
• proto-oncogene Pim-2 (serine threonine kinase)
• serine/threonine protein kinase pim-2
• serine/threonine-protein kinase pim-2

Background

PIM2 belongs to a family of cytoplasmic serine/threonine protein kinases that consists of two other members, PIM1 and PIM3. Expression of this protein is regulated by hematopoietic cytokines. PIM2 is most abundantly expressed in hematopoietic tissues, spleen, thymus, and peripheral blood leukocytes, as well as in testis, small intestine, and colon. It is also highly expressed in human leukemic and lymphoma cell lines. The gene is also expressed in primary spermatocytes. The results suggest a role for PIM2 in proliferating cells as well as during meiosis. PIM2 is thought to be a mediator of p53 mediated apoptosis inhibition by interleukin 3, which supports its role in the formation of various tumours including lymphomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PIM2 Antibody (NBP1-86193)(2)

Publications using NBP1-86193

• Brault L, Menter T, Obermann EC et al. PIM kinases are progression markers and emerging therapeutic targets in diffuse large B-cell lymphoma. Br J Cancer 2012-07-24 [PMID: 22722314] (WB)
• Santio NM, Vahakoski RL, Rainio EM et al. Pim-selective inhibitor DHPCC-9 reveals Pim kinases as potent stimulators of cancer cell migration and invasion. Mol Cancer 2010-10-19 [PMID: 20958956]

Bioinformatics

• Gene Symbol: PIM2