PIM1 Antibody (2C8)

Images

 
Immunocytochemistry/ Immunofluorescence: PIM1 Antibody (2C8) [H00005292-M02] - Analysis of monoclonal antibody to PIM1 on HeLa cell . Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PIM1 Antibody (2C8) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
PIM1 (AAH20224.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGF
Localization
Cytoplasmic and nuclear.
Specificity
PIM1 - pim-1 oncogene
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIM1 Antibody (2C8)

  • EC 2.7.11.1
  • Oncogene PIM1
  • PIM
  • pim-1 kinase 44 kDa isoform
  • pim-1 oncogene (proviral integration site 1)
  • pim-1 oncogene
  • PIM1
  • proto-oncogene serine/threonine-protein kinase pim-1

Background

The protooncogene PIM1 encodes a protein kinase upregulated in prostate cancer (Dhanasekaran et al., 2001 [PubMed 11518967]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-02441
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00415116-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
203-IL
Species: Hu
Applications: BA
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
202-IL
Species: Hu
Applications: BA
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
M6000B
Species: Mu
Applications: ELISA
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow

Publications for PIM1 Antibody (H00005292-M02) (0)

There are no publications for PIM1 Antibody (H00005292-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIM1 Antibody (H00005292-M02) (0)

There are no reviews for PIM1 Antibody (H00005292-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PIM1 Antibody (H00005292-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIM1 Products

Diseases for PIM1 Antibody (H00005292-M02)

Discover more about diseases related to PIM1 Antibody (H00005292-M02).
 

Pathways for PIM1 Antibody (H00005292-M02)

View related products by pathway.

PTMs for PIM1 Antibody (H00005292-M02)

Learn more about PTMs related to PIM1 Antibody (H00005292-M02).
 

Research Areas for PIM1 Antibody (H00005292-M02)

Find related products by research area.

Blogs on PIM1

There are no specific blogs for PIM1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIM1 Antibody (2C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PIM1
Entrez
OMIM
Uniprot