PILR-beta Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PILR-beta Antibody [NBP1-84701] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: PILR-beta Antibody [NBP1-84701] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PILR-beta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AGHPEIGEAAVAVHQGDQTHHHPGCHNHHHLEAQQHNHHSRPQGHRKQRALRIMAPKSGHCHQGCIGCRCAQNCHFGTAVPPPPVVEEKER
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PILRB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PILR-beta Protein (NBP1-84701PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PILR-beta Antibody

  • activating receptor PILRbeta
  • Activating receptor PILR-beta
  • Cell surface receptor FDFACT
  • cell surface receptor FDFACT1
  • cell surface receptor FDFACT2
  • FDFACT
  • FDFACT1
  • FDFACT2
  • paired immunoglobin-like receptor beta
  • paired immunoglobin-like type 2 receptor beta
  • paired immunoglobulin-like receptor beta
  • paired immunoglobulin-like type 2 receptor beta
  • PILRB
  • PILRbeta
  • PILR-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DDX0230P-100
Species: Hu
Applications: WB, Flow, IP
AF3968
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-83276
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB5240
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-84185
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-59072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P, MeDIP
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
AF4309
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-84701
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for PILR-beta Antibody (NBP1-84701) (0)

There are no publications for PILR-beta Antibody (NBP1-84701).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PILR-beta Antibody (NBP1-84701) (0)

There are no reviews for PILR-beta Antibody (NBP1-84701). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PILR-beta Antibody (NBP1-84701) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PILR-beta Products

Bioinformatics Tool for PILR-beta Antibody (NBP1-84701)

Discover related pathways, diseases and genes to PILR-beta Antibody (NBP1-84701). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PILR-beta Antibody (NBP1-84701)

Discover more about diseases related to PILR-beta Antibody (NBP1-84701).
 

Pathways for PILR-beta Antibody (NBP1-84701)

View related products by pathway.

PTMs for PILR-beta Antibody (NBP1-84701)

Learn more about PTMs related to PILR-beta Antibody (NBP1-84701).
 

Research Areas for PILR-beta Antibody (NBP1-84701)

Find related products by research area.

Blogs on PILR-beta

There are no specific blogs for PILR-beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PILR-beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PILRB
Entrez