PILR-beta Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PILR-beta Antibody [NBP1-84701] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Analysis in human cell line SK-BR-3.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PILR-beta Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PILR-beta Antibody - BSA Free (NBP1-84701) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AGHPEIGEAAVAVHQGDQTHHHPGCHNHHHLEAQQHNHHSRPQGHRKQRALRIMAPKSGHCHQGCIGCRCAQNCHFGTAVPPPPVVEEKER
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PILRB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PILR-beta Protein (NBP1-84701PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PILR-beta Antibody - BSA Free

• activating receptor PILRbeta
• Activating receptor PILR-beta
• Cell surface receptor FDFACT
• cell surface receptor FDFACT1
• cell surface receptor FDFACT2
• FDFACT
• FDFACT1
• FDFACT2
• paired immunoglobin-like receptor beta
• paired immunoglobin-like type 2 receptor beta
• paired immunoglobulin-like receptor beta
• paired immunoglobulin-like type 2 receptor beta
• PILRB
• PILRbeta
• PILR-beta

Background

PILRB also known as Paired immunoglobulin-like type 2 receptor beta, has 3 isoforms, a 790 amino acid isoform that is 87 kDa, a 789 amino acid isoform that is 87 kDa, and a 562 amino acid isoform that is 63 kDa; widely involved in the regulation of the immune consists of highly related activating and inhibitory receptors, thought to act as a cellular signaling activating receptor that associates with ITAM-bearing adapter molecules on the cell surface. This protein has been studied for its involvement in Williams-Beuren syndrome and pneumonia. The PILRB protein has also shown an interaction with ABHD16A, PTPN11, PTPN6, SAMSN1, and LYN in the B cell receptor signaling pathway and IL-3 signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PILRB