PILR-beta Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: AGHPEIGEAAVAVHQGDQTHHHPGCHNHHHLEAQQHNHHSRPQGHRKQRALRIMAPKSGHCHQGCIGCRCAQNCHFGTAVPPPPVVEEKER |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PILRB |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 µg/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PILR-beta Antibody - BSA Free
Background
PILRB also known as Paired immunoglobulin-like type 2 receptor beta, has 3 isoforms, a 790 amino acid isoform that is 87 kDa, a 789 amino acid isoform that is 87 kDa, and a 562 amino acid isoform that is 63 kDa; widely involved in the regulation of the immune consists of highly related activating and inhibitory receptors, thought to act as a cellular signaling activating receptor that associates with ITAM-bearing adapter molecules on the cell surface. This protein has been studied for its involvement in Williams-Beuren syndrome and pneumonia. The PILRB protein has also shown an interaction with ABHD16A, PTPN11, PTPN6, SAMSN1, and LYN in the B cell receptor signaling pathway and IL-3 signaling pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Flow, IP, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, IB, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Publications for PILR-beta Antibody (NBP1-84701) (0)
There are no publications for PILR-beta Antibody (NBP1-84701).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PILR-beta Antibody (NBP1-84701) (0)
There are no reviews for PILR-beta Antibody (NBP1-84701).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PILR-beta Antibody (NBP1-84701) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PILR-beta Products
Research Areas for PILR-beta Antibody (NBP1-84701)
Find related products by research area.
|
Blogs on PILR-beta