PIKFyve/PIP5K3 Antibody

Images

 
Immunohistochemistry: PIKFyve/PIP5K3 Antibody [NBP1-89613] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIKFyve/PIP5K3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NVELDNVNFHIKKPSKYPHVPPHPADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENGEKQA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIKFYVE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIKFyve/PIP5K3 Protein (NBP1-89613PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIKFyve/PIP5K3 Antibody

  • 1-phosphatidylinositol-3-phosphate 5-kinase
  • EC 2.7.1.150
  • FAB1
  • FLJ37746
  • FYVE finger-containing phosphoinositide kinase
  • KIAA0981CFD
  • MGC40423
  • p235
  • Phosphatidylinositol-3-phosphate 5-kinase type III
  • Phosphatidylinositol-3-phosphate 5-kinase
  • phosphoinositide kinase, FYVE finger containing
  • PIKFyve
  • PIP5K
  • PIP5K3
  • PIP5K3FAB1
  • PIPkin-III
  • Type III PIP kinase
  • type III

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
26160002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92272
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-07799
Species: Hu
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PIKFyve/PIP5K3 Antibody (NBP1-89613) (0)

There are no publications for PIKFyve/PIP5K3 Antibody (NBP1-89613).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIKFyve/PIP5K3 Antibody (NBP1-89613) (0)

There are no reviews for PIKFyve/PIP5K3 Antibody (NBP1-89613). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PIKFyve/PIP5K3 Antibody (NBP1-89613) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIKFyve/PIP5K3 Products

Bioinformatics Tool for PIKFyve/PIP5K3 Antibody (NBP1-89613)

Discover related pathways, diseases and genes to PIKFyve/PIP5K3 Antibody (NBP1-89613). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIKFyve/PIP5K3 Antibody (NBP1-89613)

Discover more about diseases related to PIKFyve/PIP5K3 Antibody (NBP1-89613).
 

Pathways for PIKFyve/PIP5K3 Antibody (NBP1-89613)

View related products by pathway.

PTMs for PIKFyve/PIP5K3 Antibody (NBP1-89613)

Learn more about PTMs related to PIKFyve/PIP5K3 Antibody (NBP1-89613).
 

Research Areas for PIKFyve/PIP5K3 Antibody (NBP1-89613)

Find related products by research area.

Blogs on PIKFyve/PIP5K3

There are no specific blogs for PIKFyve/PIP5K3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIKFyve/PIP5K3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIKFYVE
Entrez