PIP5K2 gamma Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLI |
| Predicted Species |
Mouse (95%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PIP4K2C |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PIP5K2 gamma Antibody - BSA Free
Background
PIP5K2 also known as Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma, has 3 isoforms, a 421 amino acid isoform that is 47 kDa, a 373 amino-acid isoform that is 42 kDa and a 403 amino-acid isoform that is 45 kDa; mostly found in the cytosol and surrounding plasma membrane; may be important in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum. Disease research is currently being studied with relation to PIP5K2 and rheumatoid arthritis and arthritis. This protein has interactions with BTK, STK11, PIP4K2C, PIK3CG, PIK3R3, PIP5K1A, and over 40 other proteins in D-myo-inositol-5-phosphate metabolism, regulation of actin cytoskeleton, B cell Receptor signaling pathway, D-myo-inositol (1,4,5)-trisphosphate biosynthesis, superpathway of inositol phosphate compounds, inositol phosphate metabolism, and phosphatidylinositol signaling system pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC
Publications for PIP5K2 gamma Antibody (NBP1-92272) (0)
There are no publications for PIP5K2 gamma Antibody (NBP1-92272).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PIP5K2 gamma Antibody (NBP1-92272) (0)
There are no reviews for PIP5K2 gamma Antibody (NBP1-92272).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for PIP5K2 gamma Antibody (NBP1-92272) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PIP5K2 gamma Products
Blogs on PIP5K2 gamma