PIGQ Antibody


Western Blot: PIGQ Antibody [NBP1-83343] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PIGQ Antibody [NBP1-83343] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cell.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PIGQ Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EDQVMLIFYDQRQVLLSQLHLPTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDE
Specificity of human PIGQ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIGQ Protein (NBP1-83343PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PIGQ Antibody

  • c407A10.1 (GPI1 (N-acetylglucosaminyl transferase component))
  • c407A10.1
  • class Q
  • EC
  • hGPI1
  • MGC12693
  • N-acetylglucosaminyl transferase component Gpi1
  • N-acetylglucosamyl transferase component GPI1
  • phosphatidylinositol glycan anchor biosynthesis, class Q
  • phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
  • Phosphatidylinositol-glycan biosynthesis class Q protein
  • PIG-Q


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Ca
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP, Flow-CS
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC

Publications for PIGQ Antibody (NBP1-83343) (0)

There are no publications for PIGQ Antibody (NBP1-83343).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGQ Antibody (NBP1-83343) (0)

There are no reviews for PIGQ Antibody (NBP1-83343). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGQ Antibody (NBP1-83343) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PIGQ Products

Bioinformatics Tool for PIGQ Antibody (NBP1-83343)

Discover related pathways, diseases and genes to PIGQ Antibody (NBP1-83343). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGQ Antibody (NBP1-83343)

Discover more about diseases related to PIGQ Antibody (NBP1-83343).

Pathways for PIGQ Antibody (NBP1-83343)

View related products by pathway.

PTMs for PIGQ Antibody (NBP1-83343)

Learn more about PTMs related to PIGQ Antibody (NBP1-83343).

Blogs on PIGQ

There are no specific blogs for PIGQ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PIGQ Antibody and receive a gift card or discount.


Gene Symbol PIGQ