PIGP Antibody (2E7) - Azide and BSA Free

Sandwich ELISA: PIGP Antibody (2E7) [H00051227-M01] - Detection limit for recombinant GST tagged PIGP is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2E7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PIGP Antibody (2E7) - Azide and BSA Free Summary

• Immunogen: PIGP (NP_710149, 77 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTKN
• Specificity: PIGP - phosphatidylinositol glycan, class P
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PIGP
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIGP Antibody (2E7) - Azide and BSA Free

• class P
• DCRCDown syndrome critical region protein C
• Down syndrome critical region protein 5
• DSCR5DCRC-S
• DSCRC
• DSRC
• EC 2.4.1.198
• phosphatidylinositol glycan anchor biosynthesis, class P
• Phosphatidylinositol-glycan biosynthesis class P protein
• phosphatidylinositol-n-acetylglucosaminyltranferase subunit
• PIG-P

Background

This gene encodes an enzyme involved in the first step of glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. The encoded protein is a component of the GPI-N-acetylglucosaminyltransferase complex that catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). This gene is located in the Down Syndrome critical region on chromosome 21 and is a candidate for the pathogenesis of Down syndrome. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIGP
• Entrez:
  • 51227(Human)
• OMIM:
  • 605938(Human)
• Uniprot:
  • NP_710149(Human)