PICK1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PICK1 Antibody [NBP2-57239] - Staining of human cell line HEK 293 shows localization to mitochondria. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PICK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PICK1 Antibody - BSA Free (NBP2-57239) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLD
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PICK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PICK1 Recombinant Protein Antigen (NBP2-57239PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PICK1 Antibody - BSA Free

• alpha binding protein
• dJ1039K5
• MGC15204
• PICK
• PRKCA-binding protein
• PRKCABPprotein interacting with PRKCA
• Protein interacting with C kinase 1
• protein interacting with PRKCA 1
• Protein kinase C-alpha-binding protein

Background

PSD-95/DLG/ZO-1 (PDZ) domain-containing proteins play a central role in synaptic membrane protein localization. The protein interacting with protein kinase C (PICK 1) is a synaptic PDZ domain protein that also contains a coiled-coil and acidic domain. Studies indicate that PICK 1 functions as a targeting and transport protein and has been shown to interact with protein kinase C alpha (PKC alpha), AMPA-type glutamate receptors, and several other membrane receptors via its PDZ domain. The interaction of PICK 1 with PKC alpha is highly dependent on the activation of the kinase. It appears that PICK 1 directs the activated form of PKC alpha to membrane anchored GluR2. Once phosphorylated by PKC alpha, GluR2 is released from the synaptic anchor proteins. Once released, GluR2 is transported from the synaptic membrane in a PICK 1-dependent manner.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for PICK1 Antibody (NBP2-57239). (Showing 1 - 1 of 1 FAQ).

1. Here is a difficult request. We are looking for an antibody with the following specifications: Anti-PICK1 Reactive in mouse without sodium azide, so it can be injected into the mouse without compromising its life With PBS (for example) It does not necessarily have to be guaranteed. Have you got anything like it?
   • Unfortunately all of our anti-PICK1 mouse-reactive antibodies are supplied in sodium azide. We do have anti human PICK1 without preservatives, but that would not be suitable if you are working with mouse samples. NB100-41403 contains only 0.02% sodium azide which is the lowest percentage. We also offer an Antibody Concentration and Clean Up Antibody Purification Kit which can be used to reduce the concentration of unwanted additives often found in antibody formulations, such as sodium azide, glycine or tris. This kit is offered in two sizes: cat# 861-0005 includes 1 column and cat# 861-0010 includes 3 columns.

Bioinformatics

• Gene Symbol: PICK1