Recombinant Human PIBF1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PIBF1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 660-755 of Human PIBF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EKSALLQTKNQMALDLEQLLNHREELAAMKQILVKMHSKHSENSLLLTKTEPKHVTENQKSKTLNVPKEHEDNIFTPKPTLFTKKEAPEWSKKQKM

Protein/Peptide Type
Partial Recombinant Protein
Gene
PIBF1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00010464-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PIBF1 Protein

  • C13orf24
  • chromosome 13 open reading frame 24
  • KIAA1008
  • PIBF
  • PIBF1
  • progesterone immunomodulatory binding factor 1
  • progesterone-induced blocking factor 1
  • progesterone-induced-blocking factor 1
  • RP11-505F3.1

Background

C13orf24 - chromosome 13 open reading frame 24

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5415
Species: Hu
Applications: WB, IHC, ICC
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-43123
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, CyTOF-ready
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-597
Species: Hu, Mu, Rt
Applications: WB, Flow, IP
AF745
Species: Mu
Applications: WB, Block

Publications for PIBF1 Partial Recombinant Protein (H00010464-Q01)(1)

Reviews for PIBF1 Partial Recombinant Protein (H00010464-Q01) (0)

There are no reviews for PIBF1 Partial Recombinant Protein (H00010464-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIBF1 Partial Recombinant Protein (H00010464-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIBF1 Products

Bioinformatics Tool for PIBF1 Partial Recombinant Protein (H00010464-Q01)

Discover related pathways, diseases and genes to PIBF1 Partial Recombinant Protein (H00010464-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIBF1 Partial Recombinant Protein (H00010464-Q01)

Discover more about diseases related to PIBF1 Partial Recombinant Protein (H00010464-Q01).
 

Pathways for PIBF1 Partial Recombinant Protein (H00010464-Q01)

View related products by pathway.

PTMs for PIBF1 Partial Recombinant Protein (H00010464-Q01)

Learn more about PTMs related to PIBF1 Partial Recombinant Protein (H00010464-Q01).

Blogs on PIBF1

There are no specific blogs for PIBF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PIBF1 Antibody
NBP2-19823
IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PIBF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIBF1
Entrez