PI4K2A Antibody (3E1) - Azide and BSA Free

Sandwich ELISA: PI4K2A Antibody (3E1) [H00055361-M01] - Detection limit for recombinant GST tagged PI4K2A is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 3E1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PI4K2A Antibody (3E1) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PI4K2A Antibody (3E1) - Azide and BSA Free (H00055361-M01) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PI4KII (NP_060895.1, 383 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFS
• Specificity: PI4KII - phosphatidylinositol 4-kinase type II (3E1)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PI4K2A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PI4K2A Antibody (3E1) - Azide and BSA Free

• DKFZp761G1923
• EC 2.7.1.67
• phosphatidylinositol 4-kinase type 2 alpha
• phosphatidylinositol 4-kinase type 2-alpha
• phosphatidylinositol 4-kinase type II (PI4KII)
• Phosphatidylinositol 4-kinase type II-alpha
• PI4KII
• PIK42A
• RP11-548K23.6

Background

Phosphatidylinositolpolyphosphates (PtdInsPs) are centrally involved in many biologic processes, ranging from cell growth and organization of the actin cytoskeleton to endo- and exocytosis. PI4KII phosphorylates PtdIns at the D-4 position, an essential step in the biosynthesis of PtdInsPs (Barylko et al., 2001 [PubMed 11244087]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PI4K2A
• Entrez:
  • 55361(Human)
• Uniprot:
  • NP_060895(Human)