Recombinant Human PI 3-Kinase p110 delta GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PI 3-Kinase p110 delta GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 138-247 of Human PI 3-Kinase p110 delta

Source: Wheat Germ (in vitro)

Amino Acid Sequence: DFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PIK3CD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PI 3-Kinase p110 delta GST (N-Term) Protein

  • EC 2.7.1
  • EC 2.7.1.153
  • p110D
  • P110DELTA
  • Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta
  • phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  • phosphoinositide-3-kinase C
  • phosphoinositide-3-kinase, catalytic, delta polypeptide
  • PI 3Kinase p110 delta
  • PI 3-Kinase p110 delta
  • PI3K
  • PI3K-delta
  • PI3-kinase p110 subunit delta
  • PI3-kinase subunit delta
  • PIK3CD
  • PtdIns-3-kinase subunit delta
  • PtdIns-3-kinase subunit p110-delta

Background

PIK3CD - phosphoinositide-3-kinase, catalytic, delta polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DVE00
Species: Hu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
291-G1
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
H00005293-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01) (0)

There are no publications for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01) (0)

There are no reviews for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PI 3-Kinase p110 delta Products

Bioinformatics Tool for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01)

Discover related pathways, diseases and genes to PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01)

Discover more about diseases related to PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01).
 

Pathways for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01)

View related products by pathway.

PTMs for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01)

Learn more about PTMs related to PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01).
 

Research Areas for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01)

Find related products by research area.

Blogs on PI 3-Kinase p110 delta.

PI3 Kinase p110 delta - A cell-type specific lipid kinase with essential roles in leukocyte biology
Phosphatidylinositol 3-kinases (PI3Ks) are a group of lipid kinases with important roles in signal transduction. PI3Ks are involved in signal propagation for diverse receptors including tyrosine kinase receptors and G-protein coupled receptors. Cla...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PI 3-Kinase p110 delta GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3CD