Recombinant Human PI 3-Kinase p110 delta Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PI 3-Kinase p110 delta Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 138 - 247 of Human PIK3CD partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRH

Protein/Peptide Type
Partial Recombinant Protein
Gene
PIK3CD

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PI 3-Kinase p110 delta Protein

  • EC 2.7.1
  • EC 2.7.1.153
  • p110D
  • P110DELTA
  • Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta
  • phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  • phosphoinositide-3-kinase C
  • phosphoinositide-3-kinase, catalytic, delta polypeptide
  • PI 3Kinase p110 delta
  • PI 3-Kinase p110 delta
  • PI3K
  • PI3K-delta
  • PI3-kinase p110 subunit delta
  • PI3-kinase subunit delta
  • PIK3CD
  • PtdIns-3-kinase subunit delta
  • PtdIns-3-kinase subunit p110-delta

Background

PIK3CD - phosphoinositide-3-kinase, catalytic, delta polypeptide

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00005293-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01) (0)

There are no publications for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01) (0)

There are no reviews for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PI 3-Kinase p110 delta Products

Bioinformatics Tool for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01)

Discover related pathways, diseases and genes to PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01)

Discover more about diseases related to PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01).
 

Pathways for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01)

View related products by pathway.

PTMs for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01)

Learn more about PTMs related to PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01).
 

Research Areas for PI 3-Kinase p110 delta Partial Recombinant Protein (H00005293-Q01)

Find related products by research area.

Blogs on PI 3-Kinase p110 delta.

PI3 Kinase p110 delta - A cell-type specific lipid kinase with essential roles in leukocyte biology
Phosphatidylinositol 3-kinases (PI3Ks) are a group of lipid kinases with important roles in signal transduction. PI3Ks are involved in signal propagation for diverse receptors including tyrosine kinase receptors and G-protein coupled receptors. Cla...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PI 3-Kinase p110 delta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3CD
Entrez