Recombinant Human PHYH Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PHYH Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 338 of Human PHYH full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEQLRAAARLQIVLGHLGRPSAGAVVAHPTSGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PHYH

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PHYH Protein

  • LNAP1
  • PAHXLN1
  • peroxisomal
  • PhyH
  • PHYH1
  • phytanoyl-CoA 2-hydroxylase
  • phytanoyl-CoA hydroxylase (Refsum disease)
  • phytanoyl-CoA hydroxylase
  • RD

Background

PHYH( AAH29512, 1 a.a. - 339 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-38473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
MAB2358
Species: Hu, Mu
Applications: IHC, ICC

Publications for PHYH Recombinant Protein (H00005264-P01) (0)

There are no publications for PHYH Recombinant Protein (H00005264-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHYH Recombinant Protein (H00005264-P01) (0)

There are no reviews for PHYH Recombinant Protein (H00005264-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHYH Recombinant Protein (H00005264-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHYH Products

Bioinformatics Tool for PHYH Recombinant Protein (H00005264-P01)

Discover related pathways, diseases and genes to PHYH Recombinant Protein (H00005264-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHYH Recombinant Protein (H00005264-P01)

Discover more about diseases related to PHYH Recombinant Protein (H00005264-P01).
 

Pathways for PHYH Recombinant Protein (H00005264-P01)

View related products by pathway.

PTMs for PHYH Recombinant Protein (H00005264-P01)

Learn more about PTMs related to PHYH Recombinant Protein (H00005264-P01).
 

Research Areas for PHYH Recombinant Protein (H00005264-P01)

Find related products by research area.

Blogs on PHYH

There are no specific blogs for PHYH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PHYH Antibody
NBP1-87349

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PHYH Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PHYH