PHRF1 Antibody

Immunohistochemistry-Paraffin: PHRF1 Antibody [NBP2-38979] - Staining of human cerebellum shows moderate nuclear and cytoplasmic positivity in Purkinje cells.

Product Discontinued

PHRF1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ASGRVQEAARPEEVVSQTPLLRSRALVKRVTWNLQESESSAPAEDRAPRAPLHRPQKPREGAWDMEDVAPTGVRQAFSELPF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHRF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PHRF1 Antibody

• CTD binding SR like protein rA9
• CTD-binding SR-like protein rA9
• KIAA1542RNF221
• PHD and RING finger domain-containing protein 1
• PHD and ring finger domains 1

Background

PHD and RING finger domain-containing protein 1 is an uncharacterized protein that contains a PHD-type zinc finger and a RING-type zinc finger. PHRF1 is also known as RNF221 and KIAA1542.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHRF1
• Uniprot:
  • Q9P1Y6(Human)