Phospholipase D2 Antibody

Images

 
Immunohistochemistry-Paraffin: Phospholipase D2 Antibody [NBP1-87576] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Phospholipase D2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CFGVILGANTRPDLDLRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Phospholipase D2 Recombinant Protein Antigen (NBP1-87576PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Phospholipase D2 Antibody

  • Choline phosphatase 2
  • EC 3.1.4.4
  • hPLD2
  • Phosphatidylcholine-hydrolyzing phospholipase D2
  • phospholipase D2
  • PLD 2
  • PLD1C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF

Publications for Phospholipase D2 Antibody (NBP1-87576) (0)

There are no publications for Phospholipase D2 Antibody (NBP1-87576).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase D2 Antibody (NBP1-87576) (0)

There are no reviews for Phospholipase D2 Antibody (NBP1-87576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Phospholipase D2 Antibody (NBP1-87576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Phospholipase D2 Products

Bioinformatics Tool for Phospholipase D2 Antibody (NBP1-87576)

Discover related pathways, diseases and genes to Phospholipase D2 Antibody (NBP1-87576). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholipase D2 Antibody (NBP1-87576)

Discover more about diseases related to Phospholipase D2 Antibody (NBP1-87576).
 

Pathways for Phospholipase D2 Antibody (NBP1-87576)

View related products by pathway.

PTMs for Phospholipase D2 Antibody (NBP1-87576)

Learn more about PTMs related to Phospholipase D2 Antibody (NBP1-87576).
 

Research Areas for Phospholipase D2 Antibody (NBP1-87576)

Find related products by research area.

Blogs on Phospholipase D2

There are no specific blogs for Phospholipase D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phospholipase D2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLD2