PHLDB2 Antibody

Images

 
Orthogonal Strategies: Western Blot: PHLDB2 Antibody [NBP2-38238] - Analysis in human cell lines U2OS and MCF-7 using anti-PHLDB2 antibody. Corresponding PHLDB2 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: PHLDB2 Antibody [NBP2-38238] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PHLDB2 Antibody [NBP2-38238] - Staining of human stomach, upper shows strong cytoplasmic positivity in granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

PHLDB2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NPNTLKEGYISVNEINEPCGNSTNLSPSTQFPADADAVATEPATAVLASQPQSKEHFRSLEERKKQHKEGLYLSDTLPRKKTTSSISPHFSSATM
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHLDB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Proximity Ligation Assay
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Use in Proximity Ligation Assay reported in scientific literature (PMID:34952201).For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHLDB2 Protein (NBP2-38238PEP)
Publications
Read Publication using
NBP2-38238 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHLDB2 Antibody

  • pleckstrin homology-like domain, family B, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88178
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-88047
Species: Hu
Applications: WB
NBP1-84957
Species: Hu
Applications: IHC, IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-15910
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84928
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00003636-M01
Species: Hu, Pm
Applications: ELISA, ICC/IF, WB
NBP1-83398
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-32582
Species: Hu
Applications: IHC, IHC-P, KD, WB
NB100-65543
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IP, WB
H00055614-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-31054
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-57493
Species: Hu, Mu
Applications: IP, WB
NBP2-38904
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-38238
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PLA

Publications for PHLDB2 Antibody (NBP2-38238)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC-P, PLA.


Filter By Application
IHC-P
(1)
PLA
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PHLDB2 Antibody (NBP2-38238) (0)

There are no reviews for PHLDB2 Antibody (NBP2-38238). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHLDB2 Antibody (NBP2-38238) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHLDB2 Products

Bioinformatics Tool for PHLDB2 Antibody (NBP2-38238)

Discover related pathways, diseases and genes to PHLDB2 Antibody (NBP2-38238). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHLDB2 Antibody (NBP2-38238)

Discover more about diseases related to PHLDB2 Antibody (NBP2-38238).
 

Pathways for PHLDB2 Antibody (NBP2-38238)

View related products by pathway.

PTMs for PHLDB2 Antibody (NBP2-38238)

Learn more about PTMs related to PHLDB2 Antibody (NBP2-38238).

Blogs on PHLDB2

There are no specific blogs for PHLDB2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHLDB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHLDB2
Uniprot