PHKA2 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GARVKLGNLSEFLTTSFYTYLTFLDPDCDEKLFDNASEGTFSPDSDSDLVGYLEDTCNQESQDELDHYINHLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDILSVMAKAKGLEVPFVPMTLPTKVLSAHRKS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PHKA2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for PHKA2 Antibody
Background
PHKA2, also known as Phosphorylase b kinase regulatory subunit alpha, liver isoform, is a 1,235 amino acid protein that is 138 kDa, predominantly expressed in liver and other non-muscle tissues, acts as a catalyzer of the phosphorylation of serine in certain substrates, including troponin I, and its alpha chain may bind calmodulin. This protein has been linked to several diseases and disorders including glycogen storage disease, x-linked liver glycogenosis type 1, hepatitis, glycogen storage disease, type ixa2, glycogen storage disease, type ixa1, coffin-lowry syndrome, muscle glycogenosis, Japanese encephalitis, retinoschisis, metabolic disorders, encephalitis, chagas disease, fanconi syndrome, hepatitis c hypertriglyceridemia, myopathy, hypercholesterolemia, hepatocellular carcinoma, psoriasis, and pneumonia. The PHKA2 protein has also shown an interaction with SMAD9, UBE3A, RAF1, LMLN, and METTL13 in the metabolism of carbohydrates, glycogen breakdown (glycogenolysis), metabolism, glucose metabolism, calcium signaling pathway, insulin signaling pathway, and signal transduction cAMP signaling pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Bv, Hu, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Publications for PHKA2 Antibody (NBP1-92264) (0)
There are no publications for PHKA2 Antibody (NBP1-92264).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PHKA2 Antibody (NBP1-92264) (0)
There are no reviews for PHKA2 Antibody (NBP1-92264).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PHKA2 Antibody (NBP1-92264) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PHKA2 Products
Bioinformatics Tool for PHKA2 Antibody (NBP1-92264)
Discover related pathways, diseases and genes to PHKA2 Antibody (NBP1-92264). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for PHKA2 Antibody (NBP1-92264)
Discover more about diseases related to PHKA2 Antibody (NBP1-92264).
| | Pathways for PHKA2 Antibody (NBP1-92264)
View related products by pathway.
|
PTMs for PHKA2 Antibody (NBP1-92264)
Learn more about PTMs related to PHKA2 Antibody (NBP1-92264).
|
Blogs on PHKA2