PHF21A Recombinant Protein Antigen

Images

 
There are currently no images for PHF21A Protein (NBP1-92262PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PHF21A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHF21A.

Source: E.coli

Amino Acid Sequence: QEREQLEQKVKQLSNSISKCMEMKNTILARQKEMHSSLEKVKQLIRLIHGIDLSKPVDSEATVGAISNGPDCTPPANAATSTPAPSPSSQSCTANCNQG

Protein/Peptide Type
Recombinant Protein Antigen
Gene
PHF21A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-92262.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PHF21A Recombinant Protein Antigen

  • BHC80a
  • BHC80BM-006
  • BRAF35-HDAC complex protein BHC80
  • KIAA1696BRAF35/HDAC2 complex (80 kDa)
  • PHD finger protein 21A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB600-240
Species: Hu
Applications: WB, IHC-P, PLA
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010362-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-757
Species: Hu
Applications: WB, IHC-P
NB100-41418
Species: Hu
Applications: WB, IHC-P, IP
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00006328-M06
Species: Hu
Applications: WB, ELISA
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-86288
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P

Publications for PHF21A Protein (NBP1-92262PEP) (0)

There are no publications for PHF21A Protein (NBP1-92262PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF21A Protein (NBP1-92262PEP) (0)

There are no reviews for PHF21A Protein (NBP1-92262PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for PHF21A Protein (NBP1-92262PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHF21A Products

Bioinformatics Tool for PHF21A Protein (NBP1-92262PEP)

Discover related pathways, diseases and genes to PHF21A Protein (NBP1-92262PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF21A Protein (NBP1-92262PEP)

Discover more about diseases related to PHF21A Protein (NBP1-92262PEP).
 

Pathways for PHF21A Protein (NBP1-92262PEP)

View related products by pathway.

PTMs for PHF21A Protein (NBP1-92262PEP)

Learn more about PTMs related to PHF21A Protein (NBP1-92262PEP).

Blogs on PHF21A

There are no specific blogs for PHF21A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PHF21A Antibody
NBP1-92262
HDAC1 Antibody
NB100-56340
HDAC1 Antibody
NB100-56340
HDAC1 Antibody
NB100-56340

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PHF21A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF21A