Recombinant Human PHF21A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PHF21A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 331-430 of Human PHF21A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNSTMHPGTRKRA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PHF21A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PHF21A Protein

  • BHC80a
  • BHC80BM-006
  • BRAF35-HDAC complex protein BHC80
  • KIAA1696BRAF35/HDAC2 complex (80 kDa)
  • PHD finger protein 21A

Background

PHF21A - PHD finger protein 21A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB600-240
Species: Hu
Applications: WB, IHC-P, PLA
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010362-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-757
Species: Hu
Applications: WB, IHC-P
NB100-41418
Species: Hu
Applications: WB, IHC-P, IP
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00006328-M06
Species: Hu
Applications: WB, ELISA
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-86288
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-80782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P

Publications for PHF21A Partial Recombinant Protein (H00051317-Q01) (0)

There are no publications for PHF21A Partial Recombinant Protein (H00051317-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF21A Partial Recombinant Protein (H00051317-Q01) (0)

There are no reviews for PHF21A Partial Recombinant Protein (H00051317-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PHF21A Partial Recombinant Protein (H00051317-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHF21A Products

Bioinformatics Tool for PHF21A Partial Recombinant Protein (H00051317-Q01)

Discover related pathways, diseases and genes to PHF21A Partial Recombinant Protein (H00051317-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF21A Partial Recombinant Protein (H00051317-Q01)

Discover more about diseases related to PHF21A Partial Recombinant Protein (H00051317-Q01).
 

Pathways for PHF21A Partial Recombinant Protein (H00051317-Q01)

View related products by pathway.

PTMs for PHF21A Partial Recombinant Protein (H00051317-Q01)

Learn more about PTMs related to PHF21A Partial Recombinant Protein (H00051317-Q01).

Blogs on PHF21A

There are no specific blogs for PHF21A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PHF21A Antibody
NBP1-92262
HDAC1 Antibody
NB100-56340

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PHF21A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF21A