phakinin Antibody

Images

 
Immunohistochemistry-Paraffin: phakinin Antibody [NBP1-90621] - Staining of human eye shows strong positivity in the lens.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

phakinin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSRNYEEDVKLLHKQLAGCELEQMDAPIGTGLDDILETIRIQWERDVEKNRVEAGALLQAKQQAEVAHMSQTQEEKLAAALRVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BFSP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
phakinin Protein (NBP1-90621PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for phakinin Antibody

  • beaded filament structural protein 2, phakinin
  • CP47
  • CP49
  • Cytoskeletal protein, 49-kD
  • MGC142078
  • phakinin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46572
Species: Hu
Applications: WB, IHC
NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-58661
Species: Hu
Applications: IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46354
Species: Hu
Applications: WB, IHC, IF
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
MAB5695
Species: Hu, Mu
Applications: WB
H00001415-M02
Species: Hu
Applications: WB, ELISA
NBP2-58660
Species: Hu
Applications: IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-90621
Species: Hu
Applications: IHC, IHC-P

Publications for phakinin Antibody (NBP1-90621) (0)

There are no publications for phakinin Antibody (NBP1-90621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for phakinin Antibody (NBP1-90621) (0)

There are no reviews for phakinin Antibody (NBP1-90621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for phakinin Antibody (NBP1-90621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional phakinin Products

Bioinformatics Tool for phakinin Antibody (NBP1-90621)

Discover related pathways, diseases and genes to phakinin Antibody (NBP1-90621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for phakinin Antibody (NBP1-90621)

Discover more about diseases related to phakinin Antibody (NBP1-90621).
 

Pathways for phakinin Antibody (NBP1-90621)

View related products by pathway.

Blogs on phakinin

There are no specific blogs for phakinin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our phakinin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BFSP2