CRYBB2 Antibody (1F1)

Images

 
Western Blot: CRYBB2 Antibody (1F1) [H00001415-M02] - Analysis of CRYBB2 expression in transfected 293T cell line by CRYBB2 monoclonal antibody (M02), clone 1F1.Lane 1: CRYBB2 transfected lysate (Predicted MW: 23.4 ...read more
Western Blot: CRYBB2 Antibody (1F1) [H00001415-M02] - analysis of CRYBB2 in stably transfected HEK293T cell lysate. Note: membrane was blocked overnight in 3% BSA in TBST at 4C to reduce the background. Image from ...read more
ELISA: CRYBB2 Antibody (1F1) [H00001415-M02] - Detection limit for recombinant GST tagged CRYBB2 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CRYBB2 Antibody (1F1) Summary

Immunogen
CRYBB2 (NP_000487.1, 1 a.a. - 205 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASDHQTQAGKPQSLNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQWHQRGAFHPSN
Specificity
This product is specific for Human CRYBB2 monoclonal antibody (M02), clone 1F1 [Gene ID: 1415].
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CRYBB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Reviewed Applications
Read 1 Review rated 4
using
H00001415-M02 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRYBB2 Antibody (1F1)

  • Beta-B2 crystallin
  • beta-crystallin B2
  • Beta-crystallin Bp
  • CCA2
  • CRYB2A
  • CRYB2D22S665
  • crystallin, beta B2
  • eye lens structural protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-68576
Species: Hu
Applications: IHC, IHC-P
NBP2-49196
Species: Hu
Applications: IHC, IHC-P
NBP2-46354
Species: Hu
Applications: WB, IHC, IF
NBP1-32741
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-68641
Species: Hu
Applications: ICC/IF
NBP2-68799
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-68596
Species: Hu
Applications: IHC, IHC-P
NB100-2519
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-32557
Species: Hu
Applications: WB
NBP2-58660
Species: Hu
Applications: IHC, IHC-P
NBP2-58661
Species: Hu
Applications: IHC, IHC-P
NBP2-58258
Species: Hu
Applications: WB, ICC/IF
NBP1-84375
Species: Hu
Applications: WB, IHC, IHC-P
H00001419-Q01
Species: Hu
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-62297
Species: Hu
Applications: WB
H00001415-M02
Species: Hu
Applications: WB, ELISA

Publications for CRYBB2 Antibody (H00001415-M02) (0)

There are no publications for CRYBB2 Antibody (H00001415-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for CRYBB2 Antibody (H00001415-M02) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00001415-M02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot CRYBB2 H00001415-M02
Enlarge
reviewed by:
Anonymous
WB Human 11/25/2014
View

Summary

ApplicationWestern Blot
Sample TestedMouse eye extract, Wild Type Hek293t, CrybB2 overexpressing Hek293t
SpeciesHuman

Blocking

Blocking DetailsMembrane was blocked overnight in 3% BSA in TBST at 4C

Primary Anitbody

Dilution Ratio1:500 overnight in 5% BSA in TBST at 4C

Secondary Antibody

Secondary Descriptionanti-mouse
Secondary Concentration1:10,000

Details

Detection Notessecondary was for 1 hour at room temp in 3% BSA. Exposure time was 30 sec, positive control was mouse eye extract

Comments

CommentsBe sure to block overnight with BSA. One hour at room temp in BSA, 1 hour at room temp in 5% milk, and overnight at 4C in 5% milk all resulted in background issues.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRYBB2 Antibody (H00001415-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CRYBB2 Antibody (H00001415-M02)

Discover related pathways, diseases and genes to CRYBB2 Antibody (H00001415-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRYBB2 Antibody (H00001415-M02)

Discover more about diseases related to CRYBB2 Antibody (H00001415-M02).
 

Pathways for CRYBB2 Antibody (H00001415-M02)

View related products by pathway.

Blogs on CRYBB2

There are no specific blogs for CRYBB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
11/25/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol CRYBB2
Uniprot