PGM2 Antibody (1A3) - Azide and BSA Free

Western Blot: PGM2 Antibody (1A3) [H00055276-M05] - Analysis of PGM2 expression in Hela S3 NE (Cat # L013V3).

ELISA: PGM2 Antibody (1A3) [H00055276-M05] - Detection limit for recombinant GST tagged PGM2 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1A3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PGM2 Antibody (1A3) - Azide and BSA Free Summary

• Immunogen: PGM2 (AAH10087.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLE
• Specificity: PGM2 (1A3)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PGM2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PGM2 Antibody (1A3) - Azide and BSA Free

• EC 5.4.2
• EC 5.4.2.2
• EC 5.4.2.7
• FLJ10983
• Glucose phosphomutase 2
• PGM 2
• Phosphodeoxyribomutase
• phosphoglucomutase 2
• phosphoglucomutase-2
• Phosphopentomutase

Background

This enzyme participates in both the breakdown and synthesis of glucose

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PGM2 Antibody (H00055276-M05)(1)

Publication using H00055276-M05

• Katsogiannou M, Andrieu C, Baylot V et al. The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets. Mol Cell Proteomics 2014-10-02 [PMID: 25277244]

Bioinformatics

• Gene Symbol: PGM2
• Entrez:
  • 55276(Human)
• OMIM:
  • 172000(Human)
• Uniprot:
  • NP_060760(Human)