PGM2 Antibody (1A3)

Images

 
Western Blot: PGM2 Antibody (1A3) [H00055276-M05] - Analysis of PGM2 expression in Hela S3 NE (Cat # L013V3).
ELISA: PGM2 Antibody (1A3) [H00055276-M05] - Detection limit for recombinant GST tagged PGM2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PGM2 Antibody (1A3) Summary

Immunogen
PGM2 (AAH10087.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAVKRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGISRMNDLTIIQTTQGFCRYLE
Specificity
PGM2 (1A3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PGM2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publication using H00055276-M05.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PGM2 Antibody (1A3)

  • EC 5.4.2
  • EC 5.4.2.2
  • EC 5.4.2.7
  • FLJ10983
  • Glucose phosphomutase 2
  • PGM 2
  • Phosphodeoxyribomutase
  • phosphoglucomutase 2
  • phosphoglucomutase-2
  • Phosphopentomutase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005236-M01
Species: Hu, Bv
Applications: WB, ELISA, ICC/IF, IP, RNAi, S-ELISA
NBP2-45880
Species: Hu
Applications: WB, IHC, IHC-P, IF
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NBP2-66825
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03734
Species: Hu, Mu, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-66881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5075
Species: Hu, Mu, Rt
Applications: WB
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-60616
Species: Hu
NBP2-03621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-81923
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PGM2 Antibody (H00055276-M05)(1)

Reviews for PGM2 Antibody (H00055276-M05) (0)

There are no reviews for PGM2 Antibody (H00055276-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PGM2 Antibody (H00055276-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PGM2 Products

Bioinformatics Tool for PGM2 Antibody (H00055276-M05)

Discover related pathways, diseases and genes to PGM2 Antibody (H00055276-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGM2 Antibody (H00055276-M05)

Discover more about diseases related to PGM2 Antibody (H00055276-M05).
 

Pathways for PGM2 Antibody (H00055276-M05)

View related products by pathway.

PTMs for PGM2 Antibody (H00055276-M05)

Learn more about PTMs related to PGM2 Antibody (H00055276-M05).

Blogs on PGM2

There are no specific blogs for PGM2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGM2 Antibody (1A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PGM2
Entrez
OMIM
Uniprot