Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, Simple Western, ICC/IF, IHC, IHC-P, KD |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV |
Predicted Species | Mouse (94%), Rat (92%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PGAM5 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
Theoretical MW | 32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-92257 | Applications | Species |
---|---|---|
Marzio A, Kurz E, Sahni JM et al. EMSY inhibits homologous recombination repair and the interferon response, promoting lung cancer immune evasion Cell Jan 6 2022 [PMID: 34963055] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for PGAM5 Antibody (NBP1-92257)Discover more about diseases related to PGAM5 Antibody (NBP1-92257).
| Pathways for PGAM5 Antibody (NBP1-92257)View related products by pathway.
|
PTMs for PGAM5 Antibody (NBP1-92257)Learn more about PTMs related to PGAM5 Antibody (NBP1-92257).
| Research Areas for PGAM5 Antibody (NBP1-92257)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.