PGAM5 Antibody

Images

 
Genetic Strategies: Western Blot: PGAM5 Antibody [NBP1-92257] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human colon, liver, testis and tonsil using Anti-PGAM5 antibody NBP1-92257 (A) shows similar protein distribution ...read more
Immunocytochemistry/ Immunofluorescence: PGAM5 Antibody [NBP1-92257] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human colon shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: PGAM5 Antibody [NBP1-92257] - Staining of human tonsil shows moderate granular cytoplasmic positivity in germinal center cells
Simple Western: PGAM5 Antibody [NBP1-92257] - Simple Western lane view shows a specific band for PGAM5 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: PGAM5 Antibody [NBP1-92257] - Electropherogram image(s) of corresponding Simple Western lane view. PGAM5 antibody was used at 1:60 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PGAM5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIV
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PGAM5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Simple Western 1:60
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
PGAM5 Protein (NBP1-92257PEP)
Publications
Read Publication using
NBP1-92257 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PGAM5 Antibody

  • Bcl-XL-binding protein v68
  • BXLBv68
  • EC 3.1.3.16
  • MGC5352
  • phosphoglycerate mutase family member 5BXLBV68
  • serine/threonine-protein phosphatase PGAM5, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55288
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13913
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75449
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02477
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB3024
Species: Hu, Mu, Rt
Applications: KO, Simple Western, WB
MAB91871
Species: Hu
Applications: Flow (-), ICC, IHC, IHC-P, Simple Western, WB
BC100-494
Species: Dr, Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
H00002551-M03
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NB100-41418
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67481
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-87826
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-77077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-02293
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-94197
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NBP1-92257
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD

Publications for PGAM5 Antibody (NBP1-92257)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PGAM5 Antibody (NBP1-92257) (0)

There are no reviews for PGAM5 Antibody (NBP1-92257). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PGAM5 Antibody (NBP1-92257). (Showing 1 - 2 of 2 FAQ).

  1. I am interested in PGAM5 antibody (NBP1-92257) for use in mouse cells. However, as described in the information on the website and in the data sheet, the reactivity is only for human cells. Furthermore, the images of the western-blot show many nonspecific bands. I wonder if you may send me a small sample of this antibody to test the reactivity of mouse cell lines? If possible, I could test reactivity of its antibody and send images and optimized protocol. Can you please let the customer know the cross reactivity % for this?
    • The cross reactivity with mouse is 94% and rat is 92% however because we have not tested it we can't guarantee it. As per company policy, we do not provide free samples; however, we do have a program that may be of interest to you called Innovators Reward Program.
  2. Could you please tell me the concentration of your anti-PGAM5 antibody NBP1-92257? It was purchased on 5-14-13. Our batch has been aliquoted, so we no longer have the original tube with the concentration and lot#.
    • Our current lot of this antibody is at 0.3 mg/mL. It looks like you may have received a previous lot and I have emailed the lab for the concentration of that lot. It is most likely very close to the concentration of the current lot though. If you need to proceed with your studies immediately, I would recommend assuming that your lot is close to 0.3 mg/mL. I have confirmed that the concentration of the lot I suspect you received is also 0.3 mg/mL.

Secondary Antibodies

 

Isotype Controls

Additional PGAM5 Products

Bioinformatics Tool for PGAM5 Antibody (NBP1-92257)

Discover related pathways, diseases and genes to PGAM5 Antibody (NBP1-92257). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PGAM5 Antibody (NBP1-92257)

Discover more about diseases related to PGAM5 Antibody (NBP1-92257).
 

Pathways for PGAM5 Antibody (NBP1-92257)

View related products by pathway.

PTMs for PGAM5 Antibody (NBP1-92257)

Learn more about PTMs related to PGAM5 Antibody (NBP1-92257).
 

Research Areas for PGAM5 Antibody (NBP1-92257)

Find related products by research area.

Blogs on PGAM5

There are no specific blogs for PGAM5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PGAM5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PGAM5
Entrez
Uniprot