PFDN5 Antibody

Images

 
Western Blot: PFDN5 Antibody [NBP1-82639] - Analysis in control (vector only transfected HEK293T lysate) and PFDN5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: PFDN5 Antibody [NBP1-82639] - Staining of human small intestine shows strong cytoplasmic and membrane positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PFDN5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTA
Specificity
Specificity of human PFDN5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PFDN5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
WB, ICC/IF reported in scientific literature (PMID: 26619345). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using
NBP1-82639 in the following applications:

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26619345).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PFDN5 Antibody

  • c-myc binding protein
  • C-Myc-binding protein Mm-1
  • MM-1
  • MM1MGC71907
  • Myc modulator 1
  • myc modulator-1
  • PFD5MGC5329
  • prefoldin 5
  • prefoldin subunit 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
H00026292-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
7270-IL/CF
Species: Hu
NBP2-58327
Species: Hu
Applications: WB, ICC/IF
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2350
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00079092-Q01
Species: Hu
NBP1-88262
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19983
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34330
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NBP1-82806
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
AF2818
Species: Hu
Applications: WB, ICC
NB100-793
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA, IF
NBP1-82639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PFDN5 Antibody (NBP1-82639)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PFDN5 Antibody (NBP1-82639) (0)

There are no reviews for PFDN5 Antibody (NBP1-82639). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PFDN5 Antibody (NBP1-82639) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PFDN5 Products

Bioinformatics Tool for PFDN5 Antibody (NBP1-82639)

Discover related pathways, diseases and genes to PFDN5 Antibody (NBP1-82639). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PFDN5 Antibody (NBP1-82639)

Discover more about diseases related to PFDN5 Antibody (NBP1-82639).
 

Pathways for PFDN5 Antibody (NBP1-82639)

View related products by pathway.

PTMs for PFDN5 Antibody (NBP1-82639)

Learn more about PTMs related to PFDN5 Antibody (NBP1-82639).

Blogs on PFDN5

There are no specific blogs for PFDN5, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PFDN5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PFDN5
Novus 100% Guarantee