PFDN4 Recombinant Protein Antigen

Images

 
There are currently no images for PFDN4 Protein (NBP1-88526PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PFDN4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PFDN4.

Source: E. coli

Amino Acid Sequence: DVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PFDN4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88526.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PFDN4 Recombinant Protein Antigen

  • C-1
  • PFD4C1prefoldin 4
  • prefoldin subunit 4
  • Protein C-1

Background

PFDN4, also known as Prefoldin subunit 4, is a 134 amino acid protein that is 15 kDa, binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it, promotes folding in an environment in which there are many competing pathways for nonnative proteins, and is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. Current research is being performed on this protein involvement in b-cell non-hodgkin lymphoma, non-hodgkin lymphoma, hodgkin's lymphoma, hereditary angioedema, myocardial infarction, sinusitis, gastric cancer, colorectal cancer, breast cancer, cerebritis, cholesterol, and malaria. The PFDN4 has also been shown to have interactions with MAP3K3, ACTB, PRPF4, TUBA3E, PFDN2, and plus 80 other proteins in chaperonin-mediated protein folding, prefoldin mediated transfer of substrate to CCT/TriC, cooperation of Prefoldin and TriC/CCT in actin and tubulin folding, metabolism of proteins, and protein folding pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1936
Species: Hu
Applications: IP, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DY2037
Species: Hu
Applications: ELISA
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-91803
Species: Hu
Applications: IHC, IHC-P, WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-87492
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB

Publications for PFDN4 Protein (NBP1-88526PEP) (0)

There are no publications for PFDN4 Protein (NBP1-88526PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PFDN4 Protein (NBP1-88526PEP) (0)

There are no reviews for PFDN4 Protein (NBP1-88526PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PFDN4 Protein (NBP1-88526PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PFDN4 Products

Research Areas for PFDN4 Protein (NBP1-88526PEP)

Find related products by research area.

Blogs on PFDN4

There are no specific blogs for PFDN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PFDN4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PFDN4