We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PEX6 Recombinant Protein Antigen

Images

 
There are currently no images for PEX6 Protein (NBP1-80955PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PEX6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEX6.

Source: E. coli

Amino Acid Sequence: GAVETKLQAIFSRARRCRPAVLLLTAVDLLGRDRDGLGEDARVMAVLRHLLLNEDPLNSCPPLMVVATTSRAQDLPADVQTAFPHELEVPALSEGQRLSILRALTAHLPLGQEVNLAQLARRCAGFVVGDLYALLTHSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PEX6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80955.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PEX6 Recombinant Protein Antigen

  • PAF2
  • PAF-2peroxisome assembly factor 2
  • Peroxin-6
  • peroxisomal biogenesis factor 6peroxin-6
  • Peroxisomal-type ATPase 1
  • peroxisome biogenesis factor 6
  • PXAAA1peroxisomal AAA-type ATPase 1

Background

PEX6 encodes a member of the AAA (ATPases associated with diverse cellular activities) family of ATPases. This member is a predominantly cytoplasmic protein, which plays a direct role in peroxisomal protein import and is required for PTS1 (peroxisomal targeting signal 1, a C-terminal tripeptide of the sequence ser-lys-leu) receptor activity. Mutations in this gene cause peroxisome biogenesis disorders of complementation group 4 and complementation group 6. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80577
Species: Hu
Applications: ICC/IF, WB
NBP1-80967
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP2-94643
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-87185
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
8090-ZN
Species: Hu
Applications: EnzAct
NBP1-57578
Species: Hu
Applications: WB
NBP2-49599
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-18137
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
NBP1-32743
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-86321
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-18138
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB100-79848
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP3-47877
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP1-87035
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80955PEP
Species: Hu
Applications: AC

Publications for PEX6 Protein (NBP1-80955PEP) (0)

There are no publications for PEX6 Protein (NBP1-80955PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX6 Protein (NBP1-80955PEP) (0)

There are no reviews for PEX6 Protein (NBP1-80955PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PEX6 Protein (NBP1-80955PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PEX6 Products

Array NBP1-80955PEP

Research Areas for PEX6 Protein (NBP1-80955PEP)

Find related products by research area.

Blogs on PEX6.

COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas
Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PEX6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX6