![Western Blot: PEX5L Antibody [NBP1-91484] - Mouse Liver Lysate 1ug/ml Gel Concentration 12%](http://images.novusbio.com/fullsize2/PEX5L-Antibody-Western-Blot-NBP1-91484-img0003.jpg "Western Blot: PEX5L Antibody [NBP1-91484] - Mouse Liver Lysate 1ug/ml Gel Concentration 12%")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Synthetic peptide directed towards the C terminal of human Pex2. Peptide sequence QRKSRNQQQVPHPAISGNIWAALRIALSLMDQPELFQAANLGDLDVLLRA. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PEX5L |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This is a rabbit polyclonal antibody against Pex2 and was validated on Western blot. |
|
| Theoretical MW | 68 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunocytochemistry-Immunofluorescence-NBP2-12895-img0006.jpg)
-Western-Blot-NBP2-12895-img0009.jpg)
-Western-Blot-NBP2-12895-img0010.jpg)
-Western-Blot-NBP2-12910-img0007.jpg)
-Immunohistochemistry-NBP2-12910-img0008.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-12910-img0009.jpg)
| Publication using NBP1-91484 | Applications | Species |
|---|---|---|
| Zhang D, Pan J, Liu C et al. Identification of sodium homeostasis genes in Camelus bactrianus by whole transcriptome sequencing FEBS open bio 2022-02-11 [PMID: 35147292] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
Diseases for PEX5L Antibody (NBP1-91484)Discover more about diseases related to PEX5L Antibody (NBP1-91484).
| Pathways for PEX5L Antibody (NBP1-91484)View related products by pathway.
|
PTMs for PEX5L Antibody (NBP1-91484)Learn more about PTMs related to PEX5L Antibody (NBP1-91484).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Simple Western Fascin Antibody (833223) [Unconjugated]](https://images.novusbio.com/images2/Fascin_MAB7745_Simple_Western_16531.jpg)
![Knockout Validated Fascin Antibody (833223) [Unconjugated]](https://images.novusbio.com/images2/Fascin_MAB7745_Knockout_Validated_23042.jpg)
![Immunohistochemistry Fascin Antibody (833223) [Unconjugated]](https://images.novusbio.com/images2/Fascin_MAB7745_Immunohistochemistry_12950.jpg)
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
-Western-Blot-NBP1-47791-img0018.jpg)
-Immunocytochemistry-Immunofluorescence-NBP1-47791-img0008.jpg)
-Immunocytochemistry-Immunofluorescence-NBP1-47791-img0010.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")