PEX5 Antibody

Images

 
Independent Antibodies: Western Blot: PEX5 Antibody [NBP2-38443] - Analysis using Anti-PEX5 antibody NBP2-38443 (A) shows similar pattern to independent antibody NBP1-87185 (B).
Immunocytochemistry/ Immunofluorescence: PEX5 Antibody [NBP2-38443] - Staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human cerebral cortex.
Genetic Strategies: Western Blot: PEX5 Antibody [NBP2-38443] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PEX5 antibody. Remaining relative intensity ...read more
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining in human testis and pancreas tissues using anti-PEX5 antibody. Corresponding PEX5 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-PEX5 antibody NBP2-38443 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human colon.
Immunohistochemistry-Paraffin: PEX5 Antibody [NBP2-38443] - Staining of human lymph node.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEX5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RAQAEQWAAEFIQQQGTSDAWVDQFTRPVNTSALDMEFERAKSAIESDVDFWDKLQAELEEMAKRDAEAHPWLSDYDDLTSATYDKGYQFEEEN
Specificity
Specificity of human PEX5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PEX5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
PEX5 Knockout 293T Cell Lysate
Control Peptide
Publications
Read Publication using
NBP2-38443 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:31996685).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEX5 Antibody

  • FLJ50634
  • FLJ50721
  • Peroxin-5
  • peroxisomal biogenesis factor 5
  • Peroxisomal C-terminal targeting signal import receptor
  • peroxisomal targeting signal 1 receptor
  • peroxisomal targeting signal import receptor
  • peroxisomal targeting signal receptor 1
  • Peroxisome receptor 1peroxin-5
  • PTS1 receptor
  • PTS1-BP
  • PTS1RFLJ51948
  • PXR1peroxisomal targeting signal 1 (SKL type) receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57578
Species: Hu
Applications: WB
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-49876
Species: Hu
Applications: WB, PEP-ELISA
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86321
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-49599
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80955
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80577
Species: Hu
Applications: WB, ICC/IF
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
8090-ZN
Species: Hu
NBP1-59745
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, KD
NBP1-32925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38840
Species: Hu
Applications: IHC, IHC-P
NBP1-86210
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP1-87258
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P
H00008443-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for PEX5 Antibody (NBP2-38443)(1)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for PEX5 Antibody (NBP2-38443) (0)

There are no reviews for PEX5 Antibody (NBP2-38443). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PEX5 Antibody (NBP2-38443) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PEX5 Products

Bioinformatics Tool for PEX5 Antibody (NBP2-38443)

Discover related pathways, diseases and genes to PEX5 Antibody (NBP2-38443). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX5 Antibody (NBP2-38443)

Discover more about diseases related to PEX5 Antibody (NBP2-38443).
 

Pathways for PEX5 Antibody (NBP2-38443)

View related products by pathway.

PTMs for PEX5 Antibody (NBP2-38443)

Learn more about PTMs related to PEX5 Antibody (NBP2-38443).

Blogs on PEX5

There are no specific blogs for PEX5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEX5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX5
Uniprot
COVID-19 update