PEX26 Antibody - Azide and BSA Free

Western Blot: PEX26 Antibody [H00055670-B01P] - Analysis of PEX26 expression in human spleen.

Western Blot: PEX26 Antibody [H00055670-B01P] - Analysis of PEX26 expression in transfected 293T cell line by PEX26 polyclonal antibody. Lane 1: PEX26 transfected lysate(33.55 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PEX26 Antibody - Azide and BSA Free Summary

• Immunogen: PEX26 (NP_060399.1, 1 a.a. - 305 a.a.) full-length human protein. MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCERAWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKVLELCILLYSKMQEPGAVLDVVGAWLQDPANQNLPEYGALAEFHVQRVLLPLGCLSEAEELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLWDSAVSHFFSLPFKKSLLAALILCLLVVRFDPASPSSLHFLYKLAQLFRWIRKAAFSRLYQLRIRD
• Specificity: PEX26,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PEX26
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: This antibody is useful for ELISA and Western Blot.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PEX26 Antibody - Azide and BSA Free

• FLJ20695
• peroxin-26
• peroxisomal biogenesis factor 26
• peroxisome assembly protein 26
• peroxisome biogenesis disorder, complementation group 8
• peroxisome biogenesis disorder, complementation group A
• peroxisome biogenesis factor 26
• PEX26M1T
• Pex26pM1T

Background

This gene belongs to the peroxin-26 gene family. It is probably required for protein import into peroxisomes. It anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into peroxisomes. Defects in this gene are the cause of peroxisome biogenesis disorder complementation group 8 (PBD-CG8). PBD refers to a group of peroxisomal disorders arising from a failure of protein import into the peroxisomal membrane or matrix. The PBD group is comprised of four disorders: Zellweger syndrome (ZWS), neonatal adrenoleukodystrophy (NALD), infantile Refsum disease (IRD), and classical rhizomelic chondrodysplasia punctata (RCDP). Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PEX26
• Entrez:
  • 55670(Human)
• Uniprot:
  • NP_060399.1(Human)