Recombinant Human PEX10 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PEX10 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 326 of Human PEX10 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPAAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGITYLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQLYGFRQRQRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
PEX10
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PEX10 Protein

  • NALD
  • peroxin 10
  • peroxin-10
  • peroxisomal biogenesis factor 10MGC1998
  • Peroxisome assembly protein 10
  • RING finger protein 69
  • RNF69peroxisome biogenesis factor 10

Background

PEX10( AAH18198, 1 a.a. - 327 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49599
Species: Hu
Applications: WB, IHC
NBP1-87351
Species: Hu
Applications: IHC, IHC-P
8090-ZN
Species: Hu
NBP1-49881
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP1-87185
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NBP2-33556
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu
Applications: WB
NBP2-46476
Species: Hu
Applications: WB, IHC
NBP1-80955
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86321
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86210
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP1-59704
Species: Hu
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85828
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005192-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for PEX10 Recombinant Protein (H00005192-P01) (0)

There are no publications for PEX10 Recombinant Protein (H00005192-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PEX10 Recombinant Protein (H00005192-P01) (0)

There are no reviews for PEX10 Recombinant Protein (H00005192-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PEX10 Recombinant Protein (H00005192-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PEX10 Products

Bioinformatics Tool for PEX10 Recombinant Protein (H00005192-P01)

Discover related pathways, diseases and genes to PEX10 Recombinant Protein (H00005192-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PEX10 Recombinant Protein (H00005192-P01)

Discover more about diseases related to PEX10 Recombinant Protein (H00005192-P01).
 

Pathways for PEX10 Recombinant Protein (H00005192-P01)

View related products by pathway.

PTMs for PEX10 Recombinant Protein (H00005192-P01)

Learn more about PTMs related to PEX10 Recombinant Protein (H00005192-P01).
 

Research Areas for PEX10 Recombinant Protein (H00005192-P01)

Find related products by research area.

Blogs on PEX10

There are no specific blogs for PEX10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532
PEX10 Antibody
NBP1-59745

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PEX10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PEX10