PET112L Antibody (6B2) - Azide and BSA Free

Western Blot: PET112L Antibody (6B2) [H00005188-M01] - PET112L monoclonal antibody (M01), clone 6B2 Analysis of PET112L expression in HeLa.

Sandwich ELISA: PET112L Antibody (6B2) [H00005188-M01] - Detection limit for recombinant GST tagged PET112L is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6B2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PET112L Antibody (6B2) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PET112L (NP_004555, 466 a.a. ~ 556 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLS
• Specificity: PET112L - PET112-like (yeast)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PET112
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PET112L Antibody (6B2) - Azide and BSA Free

• Cytochrome oxidase assembly factor PET112 homolog
• EC 6.3.5
• EC 6.3.5.-
• Glu-ADT subunit B
• mitochondrial
• PET112 (yeast homolog)-like
• PET112-like (yeast)

Background

Furnishes a means for formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln) (Potential)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PET112
• Entrez:
  • 5188(Human)
• OMIM:
  • 603645(Human)
• Uniprot:
  • NP_004555(Human)