Pet1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human Pet1. Peptide sequence: PLSPAVQKGSGQIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVA The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FEV |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Pet1 Antibody - BSA Free
Background
Pet1 belongs to the ETS transcription factor family. ETS family members have a highly conserved 85-amino acid ETS domain that binds purine-rich DNA sequences. The alanine-rich C-terminus of this gene indicates that it may act as a transcription repressor. This gene is exclusively expressed in neurons of the central serotonin (5-HT) system, a system implicated in the pathogeny of such psychiatric diseases as depression, anxiety, and eating disorders. In some types of Ewing tumors, this gene is fused to the Ewing sarcoma (EWS) gene following chromosome translocations.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Publications for Pet1 Antibody (NBP2-85459) (0)
There are no publications for Pet1 Antibody (NBP2-85459).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Pet1 Antibody (NBP2-85459) (0)
There are no reviews for Pet1 Antibody (NBP2-85459).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Pet1 Antibody (NBP2-85459) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Pet1 Products
Research Areas for Pet1 Antibody (NBP2-85459)
Find related products by research area.
|
Blogs on Pet1