We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Peroxiredoxin 4 Recombinant Protein Antigen

Images

 
There are currently no images for Peroxiredoxin 4 Recombinant Protein Antigen (NBP3-17000PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Peroxiredoxin 4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Peroxiredoxin 4

Source: E. coli

Amino Acid Sequence: HSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRDX4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17000.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Peroxiredoxin 4 Recombinant Protein Antigen

  • Antioxidant enzyme AOE372
  • AOE372
  • AOE37-2PRX-4
  • EC 1.11.1.15
  • Peroxiredoxin 4
  • Peroxiredoxin IV
  • peroxiredoxin-4
  • PRDX4
  • Prx4
  • prx-4
  • prx-IV
  • thioredoxin peroxidase (antioxidant enzyme)
  • Thioredoxin peroxidase AO372
  • Thioredoxin-dependent peroxide reductase A0372

Background

Peroxiredoxin-4 is encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19777
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
H00009588-M01
Species: Bv, Hu
Applications: DB, ELISA, WB
NBP3-32740
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-1160
Species: Bv, Ca, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP3-45816
Species: Hu, Mu
Applications: ELISA, IHC, IP, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
MAB7428
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
DKK300
Species: Hu
Applications: ELISA
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB

Publications for Peroxiredoxin 4 Recombinant Protein Antigen (NBP3-17000PEP) (0)

There are no publications for Peroxiredoxin 4 Recombinant Protein Antigen (NBP3-17000PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peroxiredoxin 4 Recombinant Protein Antigen (NBP3-17000PEP) (0)

There are no reviews for Peroxiredoxin 4 Recombinant Protein Antigen (NBP3-17000PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Peroxiredoxin 4 Recombinant Protein Antigen (NBP3-17000PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Peroxiredoxin 4 Products

Research Areas for Peroxiredoxin 4 Recombinant Protein Antigen (NBP3-17000PEP)

Find related products by research area.

Blogs on Peroxiredoxin 4

There are no specific blogs for Peroxiredoxin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Peroxiredoxin 4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDX4