Peroxiredoxin 4 Antibody (2C12)

Images

 
Western Blot: Peroxiredoxin 4 Antibody (2C12) [H00010549-M01] - PRDX4 monoclonal antibody (M01), clone 2C12. Analysis of PRDX4 expression in human liver.
Immunohistochemistry-Paraffin: Peroxiredoxin 4 Antibody (2C12) [H00010549-M01] - Analysis of monoclonal antibody to PRDX4 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: Peroxiredoxin 4 Antibody (2C12) [H00010549-M01] - Analysis of PRDX4 expression in transfected 293T cell line by PRDX4 monoclonal antibody (M01), clone 2C12.Lane 1: PRDX4 transfected lysate(30.5 KDa).Lane ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
2C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Peroxiredoxin 4 Antibody (2C12) Summary

Immunogen
PRDX4 (AAH03609, 51 a.a. ~ 151 a.a) partial recombinant protein with GST tag. CHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSV
Specificity
PRDX4 - peroxiredoxin 4
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRDX4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA and immunohistochemistry (paraffin).
Control
Peroxiredoxin 4 Lysate (NBP2-65990)

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Peroxiredoxin 4 Antibody (2C12)

  • Antioxidant enzyme AOE372
  • AOE372
  • AOE37-2PRX-4
  • EC 1.11.1.15
  • Peroxiredoxin 4
  • Peroxiredoxin IV
  • peroxiredoxin-4
  • PRDX4
  • Prx4
  • prx-4
  • prx-IV
  • thioredoxin peroxidase (antioxidant enzyme)
  • Thioredoxin peroxidase AO372
  • Thioredoxin-dependent peroxide reductase A0372

Background

The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1160
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P
NBP1-36991
Species: Hu
Applications: WB, PEP-ELISA
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP2-20620
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61832
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
H00010549-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for Peroxiredoxin 4 Antibody (H00010549-M01) (0)

There are no publications for Peroxiredoxin 4 Antibody (H00010549-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peroxiredoxin 4 Antibody (H00010549-M01) (0)

There are no reviews for Peroxiredoxin 4 Antibody (H00010549-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Peroxiredoxin 4 Antibody (H00010549-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Peroxiredoxin 4 Antibody (H00010549-M01)

Discover related pathways, diseases and genes to Peroxiredoxin 4 Antibody (H00010549-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peroxiredoxin 4 Antibody (H00010549-M01)

Discover more about diseases related to Peroxiredoxin 4 Antibody (H00010549-M01).
 

Pathways for Peroxiredoxin 4 Antibody (H00010549-M01)

View related products by pathway.

PTMs for Peroxiredoxin 4 Antibody (H00010549-M01)

Learn more about PTMs related to Peroxiredoxin 4 Antibody (H00010549-M01).
 

Research Areas for Peroxiredoxin 4 Antibody (H00010549-M01)

Find related products by research area.

Blogs on Peroxiredoxin 4

There are no specific blogs for Peroxiredoxin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peroxiredoxin 4 Antibody (2C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDX4
Entrez
OMIM
Uniprot