Peroxiredoxin 3 Antibody


Western Blot: Peroxiredoxin 3 Antibody [NBP2-38486] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human more
Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486] - Staining in human kidney and pancreas tissues using anti-PRDX3 antibody. Corresponding PRDX3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Peroxiredoxin 3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGK
Specificity of human Peroxiredoxin 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Peroxiredoxin 3 Lysate (NBP2-66104)
Control Peptide
Peroxiredoxin 3 Protein (NBP2-38486PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Peroxiredoxin 3 Antibody

  • Antioxidant protein 1MGC104387
  • AOP-1
  • AOP-1MGC24293
  • AOP1PRO1748
  • EC
  • HBC189
  • MER5
  • Peroxiredoxin 3
  • Peroxiredoxin III
  • peroxiredoxin-3
  • PRDX3
  • Protein MER5 homolog
  • prx-III
  • SP-22
  • thioredoxin-dependent peroxide reductase, mitochondrial


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ye
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Peroxiredoxin 3 Antibody (NBP2-38486) (0)

There are no publications for Peroxiredoxin 3 Antibody (NBP2-38486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peroxiredoxin 3 Antibody (NBP2-38486) (0)

There are no reviews for Peroxiredoxin 3 Antibody (NBP2-38486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Peroxiredoxin 3 Antibody (NBP2-38486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Peroxiredoxin 3 Antibody (NBP2-38486)

Discover related pathways, diseases and genes to Peroxiredoxin 3 Antibody (NBP2-38486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peroxiredoxin 3 Antibody (NBP2-38486)

Discover more about diseases related to Peroxiredoxin 3 Antibody (NBP2-38486).

Pathways for Peroxiredoxin 3 Antibody (NBP2-38486)

View related products by pathway.

PTMs for Peroxiredoxin 3 Antibody (NBP2-38486)

Learn more about PTMs related to Peroxiredoxin 3 Antibody (NBP2-38486).

Research Areas for Peroxiredoxin 3 Antibody (NBP2-38486)

Find related products by research area.

Blogs on Peroxiredoxin 3

There are no specific blogs for Peroxiredoxin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Peroxiredoxin 3 Antibody and receive a gift card or discount.


Gene Symbol PRDX3