Peroxiredoxin 3 Antibody

Images

 
Western Blot: Peroxiredoxin 3 Antibody [NBP2-38486] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human ...read more
Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486] - Staining in human kidney and pancreas tissues using anti-PRDX3 antibody. Corresponding PRDX3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Peroxiredoxin 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGK
Specificity
Specificity of human Peroxiredoxin 3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDX3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
Peroxiredoxin 3 Lysate (NBP2-66104)
Control Peptide
Peroxiredoxin 3 Protein (NBP2-38486PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Peroxiredoxin 3 Antibody

  • Antioxidant protein 1MGC104387
  • AOP-1
  • AOP-1MGC24293
  • AOP1PRO1748
  • EC 1.11.1.15
  • HBC189
  • MER5
  • Peroxiredoxin 3
  • Peroxiredoxin III
  • peroxiredoxin-3
  • PRDX3
  • Protein MER5 homolog
  • prx-III
  • SP-22
  • thioredoxin-dependent peroxide reductase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3254
Species: Hu, Mu, Rt
Applications: WB
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-65123
Species: Hu
NBP2-02117
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB300-864
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-81272
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24940
Species: Hu, Ye
Applications: WB
NBP2-38486
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Peroxiredoxin 3 Antibody (NBP2-38486) (0)

There are no publications for Peroxiredoxin 3 Antibody (NBP2-38486).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peroxiredoxin 3 Antibody (NBP2-38486) (0)

There are no reviews for Peroxiredoxin 3 Antibody (NBP2-38486). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Peroxiredoxin 3 Antibody (NBP2-38486) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Peroxiredoxin 3 Antibody (NBP2-38486)

Discover related pathways, diseases and genes to Peroxiredoxin 3 Antibody (NBP2-38486). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peroxiredoxin 3 Antibody (NBP2-38486)

Discover more about diseases related to Peroxiredoxin 3 Antibody (NBP2-38486).
 

Pathways for Peroxiredoxin 3 Antibody (NBP2-38486)

View related products by pathway.

PTMs for Peroxiredoxin 3 Antibody (NBP2-38486)

Learn more about PTMs related to Peroxiredoxin 3 Antibody (NBP2-38486).
 

Research Areas for Peroxiredoxin 3 Antibody (NBP2-38486)

Find related products by research area.

Blogs on Peroxiredoxin 3

There are no specific blogs for Peroxiredoxin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peroxiredoxin 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDX3
Entrez
Uniprot