Peroxiredoxin 3 Antibody - BSA Free

Western Blot: Peroxiredoxin 3 Antibody [NBP2-38486] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486] - Staining in human kidney and pancreas tissues using anti-PRDX3 antibody. Corresponding PRDX3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: Peroxiredoxin 3 Antibody [NBP2-38486] - Staining of human pancreas shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Peroxiredoxin 3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Peroxiredoxin 3 Antibody - BSA Free (NBP2-38486) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRDX3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Peroxiredoxin 3 Protein (NBP2-38486PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Peroxiredoxin 3 Antibody - BSA Free

• Antioxidant protein 1MGC104387
• AOP-1
• AOP-1MGC24293
• AOP1PRO1748
• EC 1.11.1.15
• HBC189
• MER5
• Peroxiredoxin 3
• Peroxiredoxin III
• peroxiredoxin-3
• PRDX3
• Protein MER5 homolog
• prx-III
• SP-22
• thioredoxin-dependent peroxide reductase, mitochondrial

Background

The peroxiredoxin (PRX) family comprises six antioxidant proteins, PRX I, II, III, IV, V and VI, which protect cells from reactive oxygen species (ROS) by preventing the metal-catalyzed oxidation of enzymes. The PRX proteins primarily utilize thioredoxin as the electron donor for antioxidation, although they are fairly promiscuous with regard to the hydroperoxide substrate. In addition to protection from ROS, peroxiredoxins are also involved in cell proliferation, differentiation and gene expression. PRX I, II, IV and VI show diffuse cytoplasmic localization, while PRX III and V exhibit distinct mitochondrial localization. The human PRX I gene encodes a protein that is expressed in several tissues, including liver, kidney, testis, lung and nervous system. PRX II is expressed in testis, while PRX III shows expression in lung. PRX I, II and III are overexpressed in breast cancer and may be involved in its development or progression. Upregulated protein levels of PRX I and II in Alzheimer's disease (AD) and Down syndrome (DS) indicate the involvement of PRX I and II in their pathogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRDX3
• Uniprot:
  • P30048()