Peroxiredoxin 2 Antibody

Images

 
Western Blot: Peroxiredoxin 2 Antibody [H00007001-B02P] - Analysis of PRDX2 expression in HepG2.
Western Blot: Peroxiredoxin 2 Antibody [H00007001-B02P] - Analysis of PRDX2 expression in transfected 293T cell line by PRDX2 polyclonal antibody. Lane 1: PRDX2 transfected lysate(21.90 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Peroxiredoxin 2 Antibody Summary

Immunogen
PRDX2 (NP_005800.3, 1 a.a. - 198 a.a.) full-length human protein. MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PRDX2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Peroxiredoxin 2 Antibody

  • EC 1.11.1
  • MGC4104
  • Natural killer cell-enhancing factor B
  • natural killer-enhancing factor B
  • NKEF-B
  • NKEFBNKEF-B
  • Peroxiredoxin 2
  • peroxiredoxin-2
  • PRDX2
  • PRPTDPX1
  • PRX2
  • PRXII
  • TDPX1
  • thiol-specific antioxidant 1
  • Thiol-specific antioxidant protein
  • Thioredoxin peroxidase 1
  • Thioredoxin-dependent peroxide reductase 1
  • torin
  • TPX1
  • TSA
  • TSAEC 1.11.1.15

Background

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-03351
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-B02P
Species: Hu
Applications: WB

Publications for Peroxiredoxin 2 Antibody (H00007001-B02P) (0)

There are no publications for Peroxiredoxin 2 Antibody (H00007001-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peroxiredoxin 2 Antibody (H00007001-B02P) (0)

There are no reviews for Peroxiredoxin 2 Antibody (H00007001-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Peroxiredoxin 2 Antibody (H00007001-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Peroxiredoxin 2 Products

Bioinformatics Tool for Peroxiredoxin 2 Antibody (H00007001-B02P)

Discover related pathways, diseases and genes to Peroxiredoxin 2 Antibody (H00007001-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Peroxiredoxin 2 Antibody (H00007001-B02P)

Discover more about diseases related to Peroxiredoxin 2 Antibody (H00007001-B02P).
 

Pathways for Peroxiredoxin 2 Antibody (H00007001-B02P)

View related products by pathway.

PTMs for Peroxiredoxin 2 Antibody (H00007001-B02P)

Learn more about PTMs related to Peroxiredoxin 2 Antibody (H00007001-B02P).
 

Research Areas for Peroxiredoxin 2 Antibody (H00007001-B02P)

Find related products by research area.

Blogs on Peroxiredoxin 2

There are no specific blogs for Peroxiredoxin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peroxiredoxin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDX2
Entrez
Uniprot