Peropsin Antibody - BSA Free

Western Blot: Peropsin Antibody [NBP2-84215] - Host: Rabbit. Target Name: RRH. Sample Tissue: Human HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

Peropsin Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human Peropsin. Peptide sequence: MLRNNLGNSSDSKNEDGSVFSQTEHNIVATYLIMAGMISIISNIIVLGIF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RRH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Peropsin Antibody - BSA Free

• peropsin
• retinal pigment epithelium-derived rhodopsin homolog
• visual pigment-like receptor peropsin

Background

Peropsin, a member of the Opsin subfamily of GPCRs, has been suggested to affect retinal pigment epithelium physiology by detecting light directly or by monitoring the concentration of retinoids or other photoreceptor-derived compounds. Peropsin expression has been documented in human retinal pigment epithelium.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RRH