Peropsin Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human Peropsin. Peptide sequence: MLRNNLGNSSDSKNEDGSVFSQTEHNIVATYLIMAGMISIISNIIVLGIF The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
RRH |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Peropsin Antibody - BSA Free
Background
Peropsin, a member of the Opsin subfamily of GPCRs, has been suggested to affect retinal pigment epithelium physiology by detecting light directly or by monitoring the concentration of retinoids or other photoreceptor-derived compounds. Peropsin expression has been documented in human retinal pigment epithelium.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC-FrFl, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Bt, Bv, Ca, Eq, Hu, Pm, Mu, Rb
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IP, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
Species: Bv, Hu, Mu, Po, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Publications for Peropsin Antibody (NBP2-84215) (0)
There are no publications for Peropsin Antibody (NBP2-84215).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Peropsin Antibody (NBP2-84215) (0)
There are no reviews for Peropsin Antibody (NBP2-84215).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Peropsin Antibody (NBP2-84215) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Peropsin Products
Research Areas for Peropsin Antibody (NBP2-84215)
Find related products by research area.
|
Blogs on Peropsin